KEGG   Trichomonas vaginalis: TVAG_108990Help
Entry
TVAG_108990       CDS       T01022                                 

Definition
Eukaryotic initiation factor 4E family protein
Orthology
K03259  
translation initiation factor 4E
Organism
tva  Trichomonas vaginalis
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:tva00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    TVAG_108990
Translation factors [BR:tva03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    TVAG_108990
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 173 aa AA seqDB search
MSIEKDGTLYREWTLWYLIPDRYTMKEAAWKDFLHPIADFDTIDKFWAAFNSIEKASLLP
KGCRYYVFRKGILPLWEDHANISGHEVSIEHTIAKAKKPKVNDRWEDVLFSVIGESFPYS
DKINGVEFTVRTETFKIGVWVSQTPYEVTNAISAELAKLIRWNTPVKVSEIKI
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atgtcgattgagaaggacggtacactctacagagaatggactctctggtatctcattcca
gatcgttatacaatgaaagaggcagcatggaaggactttttacatccaattgctgatttt
gatacaattgataagttctgggctgcattcaactctatcgaaaaggcatcattgcttcca
aaaggttgcagatactacgtttttagaaaaggcattcttccattgtgggaagatcacgca
aatatcagtggtcacgaagtttctatcgaacacacaatcgcaaaggccaagaaaccaaag
gttaatgacagatgggaggatgttctcttctctgttattggtgaaagcttcccatattct
gataaaattaatggcgttgagttcactgttcgtacagaaactttcaagatcggtgtttgg
gtttctcagacaccatatgaagttaccaatgctatttctgcagaattggccaagttaatc
agatggaatactccagtaaaggttagcgaaatcaagatttaa

DBGET integrated database retrieval system