KEGG   Trichomonas vaginalis: TVAG_113710Help
Entry
TVAG_113710       CDS       T01022                                 

Definition
(RefSeq) phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
tva  Trichomonas vaginalis
Pathway
tva00010  Glycolysis / Gluconeogenesis
tva00260  Glycine, serine and threonine metabolism
tva01100  Metabolic pathways
tva01110  Biosynthesis of secondary metabolites
tva01130  Biosynthesis of antibiotics
tva01200  Carbon metabolism
tva01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tva00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TVAG_113710
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TVAG_113710
Enzymes [BR:tva01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     TVAG_113710
Membrane trafficking [BR:tva04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    TVAG_113710
Exosome [BR:tva04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   TVAG_113710
  Exosomal proteins of melanoma cells
   TVAG_113710
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_1 Exc
Motif
Other DBs
NCBI-GeneID: 5463531
NCBI-ProteinID: XP_001579013
UniProt: A2DNM4
AA seq 251 aa AA seqDB search
MAAKYTIVLLRHGESEWNLENKFTGWYDCDLSAKGREEAKSAGEVLKAEGFTFDIAFTSV
LKRAIRTLWITLDGMNLMHIPVIRSWRLNERHYGALQGLNKADTAKKYGMEKVTEWRRAF
AIPPPPLEKDSPYYPGNDARYKDLDPACLPLHESLKTTIDRVLPFWFDQIVPAIKSGKKV
IIAAHGNSLRALVKYLDNMSEDEIVALNIPTAVPLVYELDENLRPVSHRYLGDQEKIAAA
INAVANQTKGK
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atggctgctaagtacactatcgtcctcctccgtcacggtgaatccgaatggaacctcgag
aacaagttcacaggctggtacgactgcgacctctctgccaagggccgtgaagaggctaag
tctgctggtgaagtcctcaaggccgaaggattcacattcgatatcgccttcacatccgtc
cttaagcgtgctatccgcacactctggatcacactcgatggcatgaacttaatgcacatc
ccagtcattcgctcatggcgtcttaacgagcgccactacggtgctctccagggcctcaac
aaggctgacacagccaagaagtacggtatggagaaggttacagaatggcgccgtgctttc
gccatcccaccaccaccacttgagaaggattctccatactacccaggcaacgatgcccgc
tacaaggacctcgacccagcttgcctcccactccacgagtccctcaagacaacaatcgat
cgtgttcttccattctggttcgaccagatcgttccagccatcaagtctggcaagaaggtc
atcatcgctgctcacggcaactccctccgtgccctcgtcaagtatcttgacaacatgtcc
gaggatgagatcgttgctctcaacatcccaacagctgttccactcgtttacgagctcgat
gagaacctccgcccagtttcccaccgctacctcggtgatcaggagaagatcgctgctgct
atcaacgctgtcgctaaccagacaaagggcaagtaa

DBGET integrated database retrieval system