KEGG   Trichomonas vaginalis: TVAG_113710Help
Entry
TVAG_113710       CDS       T01022                                 

Definition
phosphoglycerate mutase
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
tva  Trichomonas vaginalis
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tva00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TVAG_113710
   01230 Biosynthesis of amino acids
    TVAG_113710
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TVAG_113710
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TVAG_113710
Enzymes [BR:tva01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     TVAG_113710
Exosome [BR:tva04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   TVAG_113710
  Exosomal proteins of melanoma cells
   TVAG_113710
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 251 aa AA seqDB search
MAAKYTIVLLRHGESEWNLENKFTGWYDCDLSAKGREEAKSAGEVLKAEGFTFDIAFTSV
LKRAIRTLWITLDGMNLMHIPVIRSWRLNERHYGALQGLNKADTAKKYGMEKVTEWRRAF
AIPPPPLEKDSPYYPGNDARYKDLDPACLPLHESLKTTIDRVLPFWFDQIVPAIKSGKKV
IIAAHGNSLRALVKYLDNMSEDEIVALNIPTAVPLVYELDENLRPVSHRYLGDQEKIAAA
INAVANQTKGK
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atggctgctaagtacactatcgtcctcctccgtcacggtgaatccgaatggaacctcgag
aacaagttcacaggctggtacgactgcgacctctctgccaagggccgtgaagaggctaag
tctgctggtgaagtcctcaaggccgaaggattcacattcgatatcgccttcacatccgtc
cttaagcgtgctatccgcacactctggatcacactcgatggcatgaacttaatgcacatc
ccagtcattcgctcatggcgtcttaacgagcgccactacggtgctctccagggcctcaac
aaggctgacacagccaagaagtacggtatggagaaggttacagaatggcgccgtgctttc
gccatcccaccaccaccacttgagaaggattctccatactacccaggcaacgatgcccgc
tacaaggacctcgacccagcttgcctcccactccacgagtccctcaagacaacaatcgat
cgtgttcttccattctggttcgaccagatcgttccagccatcaagtctggcaagaaggtc
atcatcgctgctcacggcaactccctccgtgccctcgtcaagtatcttgacaacatgtcc
gaggatgagatcgttgctctcaacatcccaacagctgttccactcgtttacgagctcgat
gagaacctccgcccagtttcccaccgctacctcggtgatcaggagaagatcgctgctgct
atcaacgctgtcgctaaccagacaaagggcaagtaa

DBGET integrated database retrieval system