KEGG   Trichomonas vaginalis: TVAG_118130Help
Entry
TVAG_118130       CDS       T01022                                 

Definition
Dolichyl-phosphate-mannose-protein mannosyltransferase
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
tva  Trichomonas vaginalis
Pathway
Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:tva00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    TVAG_118130
Enzymes [BR:tva01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.109  dolichyl-phosphate-mannose-protein mannosyltransferase
     TVAG_118130
Glycosyltransferases [BR:tva01003]
 O-Glycan biosynthesis
  O-linked Man type (Man a1- Ser/Thr)
   TVAG_118130
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 523 aa AA seqDB search
MSVIHVTNIDSELTEGQVKRYFRHYGGIADMTFRLGKEGKHDGKAKITFYNEYAGLQAFE
KNGAMLGNYPIYISISLENQGKGSAERVYKGRLYRISEILVIILTLILSVSLHVYKISEP
AYLIGEEPLIFDHLNQYIHHKRPYDDQPPLGKLIYLGWAKLCGYKGTQKYEMQNQEYIPF
DNTTNYVFLRSLSCFCGSLVPPIVVAAISLRYHSLTALFLVGFILSLDSGLITISRSMSL
DSICLFFSAISIYYTCLLYRRNTWFNGIKSTVFAILACCIRYPAFGLFFFIFFSNWHLGF
GHPDSTWNFFSRTAGFIWIGLTILSIVTAIHLIITPKFGDADLQFPEYFRDRELAESVIL
IIWKQLRYKTGKTYKTLPQSRYIQWAFWRAPPMVIYNMRDTMIAIVNSPAIILSCFITLF
WCFLLQKFEFVFAILTSWGFLHFYKAATFMFDAYVPLIISLGGLAMVYDRLPRIFKYTIL
WLLIPLSVCGFYLFMPITYGLPMDKYRFSLIALWPTFKRTWNV
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atgagtgttattcacgtgactaatattgattccgaactgacagaaggtcaagttaagcga
tattttcgccattacggaggtatcgccgacatgacattcaggctaggaaaagaaggaaag
catgacggaaaagcaaaaattacattttataatgaatatgccggattgcaagctttcgag
aagaatggtgctatgctcggcaactatccaatttacatatcaatatcactcgagaatcaa
ggaaaaggttcagcggaaagagtttataaaggcagactttacaggatttcggaaattctt
gttatcatattaacattaatcttatcagtatcactacatgtttataaaatttcagagcca
gcatacctaattggcgaagaaccattaatatttgaccatcttaaccaatacattcatcac
aagcgtccatacgatgatcagccaccattaggtaagcttatttacctcggctgggccaag
ctttgtggctacaaaggcacacaaaaatatgaaatgcaaaatcaagaatatattccattt
gataacactacgaactatgtctttttacgttccttatcatgtttctgtggttcattagta
ccaccaattgttgtagccgcaatttcacttcgatatcactctttgacagcacttttcctt
gttggcttcattctcagcctcgatagtggccttattacaatcagcagatccatgagtctt
gactcaatttgcctctttttctcagcaatttcgatttattacacttgtctcctctatcgt
cgtaatacatggttcaatggcatcaaatccacggtctttgccatcctcgcgtgctgtatt
cgctatccagcgttcggacttttctttttcatcttcttttcgaactggcatctcggtttc
ggacatccagactctacatggaacttcttttcacgtacagccggtttcatatggattgga
ttaaccattctttccattgttactgcaattcatctgatcatcactccgaaattcggtgac
gcggacctccaattccccgaatacttcagggacagagaactcgcggagtcagtgatcctc
attatctggaagcagttgagatacaagacaggaaagacgtataaaacacttccacaaagt
agatacatacaatgggcgttttggagagctcctccaatggtcatttacaacatgagagat
acaatgatcgctattgttaactctcctgccattatattgtcatgtttcatcactttgttc
tggtgtttccttttgcaaaagttcgaatttgtttttgcaatattgacatcatggggattc
ctccatttctacaaagcagcgacatttatgttcgacgcttacgtaccattgatcatctcc
ctcggaggactcgcaatggtttacgacagattgccaagaatcttcaaatacacgattttg
tggcttttgattcctctttcagtctgcggcttctacctgttcatgccaatcacatacggc
cttccaatggataagtaccggttctctctgatcgctttatggccaactttcaagagaacg
tggaatgtttaa

DBGET integrated database retrieval system