KEGG   Trichomonas vaginalis: TVAG_120850Help
Entry
TVAG_120850       CDS       T01022                                 

Definition
Clan CA, family C19, ubiquitin hydrolase-like cysteine peptidase
Orthology
K11835  
ubiquitin carboxyl-terminal hydrolase 4/11/15 [EC:3.4.19.12]
Organism
tva  Trichomonas vaginalis
Brite
Enzymes [BR:tva01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     TVAG_120850
Peptidases [BR:tva01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   TVAG_120850
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 777 aa AA seqDB search
MDEQRKQLKAVMSTTQLTPEQNAYLISIKWFNEFKRIIGFETDIALNEKIPAIDNSGLLR
NGLLRRDIRENTDFAILTKPTWLLLKQYYGGGPDIGVKVAYNPLKHQNCAITRNIALYIL
YQQQRKQFSVTTYEKVREIKDRALVYYNLTDKSLNLYEYNNNNIENKLEDDKLLCEYAIL
DNQQLILTTAHSKKKEEPQSIFSYFSQTGTCTPGTTGLNNMGNTCFMNSTLQCLMHIELL
ANYFANTPWQKEISTTNPLGTKGELSIAFSKLLEISQRGSHSSYTPSEVRKAIIKHAPNF
DGYSQQDAHEVLLFILDGIHEDLNRITKKPQVDVVEGDGTNDNETAIKAWHAYKQRNDSI
IVDLFHGQLRSHLKCPNCQADTVAFDPFVSLSVPVPQKKILSPAFIFCPADPTQPRKIMQ
FNIDMSWSPLQTKRFIQKSEGRNLNLIYAAINHEQTEITYTLSPYRPPSTHILYAIELPS
TDKLYAPVFLKEKEKGWIWDGDTPIAGPFLVPVLKQNPSEKELNDIISNYFSFLFDTKNP
DPQEMYDKYEETRQKWRSLRDDKNKFEISIRSNFFDSGTFTPLTKMPCLTRRCVDVIVNP
SWMTKESGFKWSLFIPSRIKEFEEPVEEKSIDLEKCLDLFSEELVLDEENKWFCPKCREF
VQASKKMDIWTSPEILIIHLKRFAQISGFLTKNETEVQYPDELDMSQRIIGPHNGSCKYK
LIAVSEHHGILGSGHYTAHAMVGNQWYLFNDSSVSKCLRDMAHTKAAYVLFYAKIHE
NT seq 2334 nt NT seq  +upstreamnt  +downstreamnt
atggatgagcaacgcaaacaattgaaagcagtcatgtctacaacgcaattaacaccagaa
cagaacgcatatttaatttccattaaatggtttaatgaatttaagcgaattataggtttt
gaaactgatatcgctttaaatgagaaaatacctgctattgataatagcggattacttaga
aatggcctgcttagacgagatattcgtgaaaatacagactttgccattttaactaagcct
acatggttattattgaagcagtattatggcggaggtcctgatatcggtgttaaagttgct
tacaatccattaaaacatcaaaattgcgctattactaggaatattgctttgtacattttg
tatcaacagcaaagaaagcaattttcagttacaacatacgaaaaagttagagaaattaaa
gatagagctttagtttactacaatttaactgataaatcgctaaatttatacgaatacaac
aataataatatcgaaaataagcttgaagacgataaattactttgtgaatatgctatttta
gataatcaacagctaatacttacaacagcccattctaaaaagaaagaggagcctcaatca
attttttcatatttttcacaaacaggaacatgcacacctggtacaacaggactcaacaac
atgggaaatacgtgttttatgaattctactttacaatgtttgatgcatattgaactactt
gctaattattttgcaaatactccatggcaaaaagaaatatcaacaacaaatcctttaggt
acaaaaggtgaactatcgattgcattctccaaattactcgaaatcagtcaaagaggaagc
cattcatcatatacaccgagtgaagttcgaaaggcaatcataaaacatgcgccaaatttc
gatggatactcacaacaagacgcacacgaagttttactatttattctcgatggaattcat
gaagatttaaacagaatcacgaaaaaaccacaagttgacgttgtagaaggtgatggaaca
aacgacaatgagacagcaatcaaggcctggcatgcttacaagcaaagaaacgattctata
attgttgatttattccatggccaacttagatcacatttgaagtgtccaaactgtcaagcc
gataccgtagcttttgatcctttcgtttccctttctgttcctgttcctcagaaaaaaatt
ttatctccagctttcattttttgccctgcagacccaacgcaaccacgcaagatcatgcaa
ttcaacatagacatgtcatggtcaccactccaaactaagagattcattcagaaatccgaa
ggacgaaatttgaatttaatttatgcagcgatcaaccatgaacagaccgagataacatat
actttgtcaccttatagaccaccttccactcatattttgtacgcaattgaacttccttcg
actgataagttatatgctccagttttcttgaaagaaaaagagaaaggatggatctgggat
ggtgacactcctattgctggacctttccttgtacctgttcttaagcaaaatccatcagaa
aaagagttgaacgatataatctcaaattatttctcgtttttattcgatacgaagaatcca
gatccacaagagatgtatgataaatacgaagaaacacgtcaaaagtggcgttctcttcga
gatgacaaaaacaagtttgaaatttctatcagatccaatttctttgatagtggcacattc
acaccactcacaaagatgccatgccttacacgtagatgtgtagatgtcattgttaatcct
tcttggatgacaaaagaaagtggatttaaatggtcactttttattccatcacgaatcaaa
gaattcgaagaacctgttgaagagaaatcaattgatttggagaaatgtcttgatttattc
tctgaagaacttgttttggatgaagaaaacaaatggttttgtccgaaatgtagagaattt
gtccaagcgagtaagaagatggacatttggacatcaccagagatattgataatccatttg
aagagatttgctcaaatttctggatttttgacgaaaaatgagacagaagttcaatatcct
gacgaactcgacatgagtcaaagaataattggacctcataatggcagctgcaaatacaaa
ttaattgctgtttcagaacatcatggaattcttggaagtggtcattatacagcacacgca
atggttggaaaccaatggtatctgtttaatgatagcagtgtttctaaatgccttagagat
atggcacatacgaaagctgcttatgtcttgttttatgcaaaaattcatgaatag

DBGET integrated database retrieval system