KEGG   Trichomonas vaginalis: TVAG_123260Help
Entry
TVAG_123260       CDS       T01022                                 

Definition
Aldose 1-epimerase family protein
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
tva  Trichomonas vaginalis
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:tva00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:tva00052]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 355 aa AA seqDB search
MSAKTSSSLNIADYETTHQGKQVKLIVLKNSKGMEVCVSNFGANIVSFVVPDKDGKLRDI
VLNQPTIKDIIENSFRFTGATCGRSTNRIAKGHFIIDGNEYTCPINNDINNNHTGVSGFH
NNVWDIVEQTANKAVIRYVSVDGADGFPGNLETTLTFTVDEENALRLDFDYKTDKPTVCS
ITQHSFFNLTQPEDDVFDTDLQVFADFFTPVDDHMTPTGEVLKVAGTVFDFREPMALGKH
ILDNDDQIIKGTGYDHTFVLRKQWRNQLALAAKAFNKKSGITLEMHTDMPGMQLYTANWM
DGFAGKYGTKCDKRHAFCLEAGAIPNSINTNWFPSTTVYPGQPGHNVIVFKAGLL
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgtcagcaaagacatcctctagccttaatattgcagactacgagacaacacaccagggc
aagcaagtcaagcttatagtccttaagaactctaagggaatggaagtttgcgtttccaac
tttggcgcaaacattgtttcctttgttgtaccagataaagatggcaagcttcgtgatatc
gtccttaaccagccaacaatcaaggatatcattgagaattccttcagatttactggtgct
acatgtggcagatcaacaaacagaattgccaagggccatttcatcatcgacggcaatgag
tacacatgcccaatcaacaacgacatcaacaataaccacactggtgtctctggtttccac
aacaatgtttgggacattgtcgaacaaacagctaacaaggccgttatcagatatgtttct
gttgatggtgctgatggcttcccaggcaaccttgaaacaacactcacattcactgttgat
gaggagaatgctcttagattagacttcgactacaagacagacaagccaacagtttgctca
atcacacagcactcattcttcaacctcacacagccagaagatgatgtcttcgacacagat
cttcaggtctttgctgatttcttcacaccagttgatgatcacatgacaccaacaggcgaa
gtcctcaaggttgctggcacagtcttcgacttcagagaaccaatggccctcggcaagcac
attcttgataatgatgaccagatcattaagggaacaggctacgaccacacattcgtcctc
cgcaagcagtggagaaaccagctcgctcttgctgccaaggctttcaacaagaagtccggt
attacactcgaaatgcacacagatatgccaggcatgcaactctacacagctaactggatg
gatggatttgctggcaaatacggcacaaagtgcgacaagagacacgctttctgcctcgag
gccggtgctattccaaactccatcaacactaactggttcccatcaaccacagtctatcca
ggacagccaggacacaacgtcattgttttcaaggctggccttctctaa

DBGET integrated database retrieval system