KEGG   Trichomonas vaginalis: TVAG_133870Help
Entry
TVAG_133870       CDS       T01022                                 

Definition
(RefSeq) EF hand family protein
  KO
K06268  serine/threonine-protein phosphatase 2B regulatory subunit
Organism
tva  Trichomonas vaginalis
Brite
Protein phosphatases and associated proteins [BR:tva01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     TVAG_133870
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EF-hand_1 EF-hand_6 EF-hand_7 EF-hand_5 EF-hand_8 EF-hand_4
Motif
Other DBs
NCBI-GeneID: 4754663
NCBI-ProteinID: XP_001309817
UniProt: A2FDW9
AA seq 190 aa AA seqDB search
MGVAQSAINRGFISESDAAKMSEQSYFSERQIFVLAQIFRNLTKESQINAETFAKNMKIS
NKSIGEILYKIIDDDGSGDIDFTEFVEGLNKFHPNAPFDEKVKLCFRAYDSDGSGAVSKE
EITDVIKLSIEGSSLIELEDAQINLLVDQLINTYDNSGSGELNYKEFYQMVSSAPGVIEC
FDINLDVLFG
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atgggtgttgctcagagtgcaattaaccgaggttttatttcggagagtgatgctgctaaa
atgtctgaacagagctacttttcagaacgccagatctttgttttagcccaaattttcagg
aatttgacaaaagaatcccaaattaatgcggaaacctttgccaaaaacatgaaaattagt
aataagagtattggagaaatcctctacaagattattgatgatgatgggagcggtgacatc
gatttcactgaatttgtcgagggtctgaacaaattccatcccaatgcaccttttgatgaa
aaggtcaagctttgcttccgggcttatgatagcgatggcagtggtgcagtttcaaaagaa
gaaattacagatgtcattaagctttctatcgaaggtagtagcctaattgaacttgaagat
gctcaaattaatcttcttgttgatcaattaatcaacacttatgataattcaggaagtggt
gaacttaattacaaagaattctatcaaatggtatcctcagctcccggtgtgatagagtgc
tttgatattaatcttgatgttttgtttggttga

DBGET integrated database retrieval system