KEGG   Trichomonas vaginalis: TVAG_134820Help
Entry
TVAG_134820       CDS       T01022                                 

Definition
Glutaminase family protein
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
tva  Trichomonas vaginalis
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tva00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    TVAG_134820
   00330 Arginine and proline metabolism
    TVAG_134820
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    TVAG_134820
Enzymes [BR:tva01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     TVAG_134820
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 244 aa AA seqDB search
MQSISKVISLIMALKDNTIQDVFEKVGTEPTKYKFNSLIPIDDKPSNPLINAGAITTASL
IVGKDVDEKFQRVLNMVKKLSNSDKISFLKEVYTSEMETTDVNKSIAYYLRSKKIFSLNA
DEVLDLYIRNCSIGINATELANGGSVLANGGSDLVTGDEMVSKEAVKIVLAQMASCGMYE
ESGEFLLNVGIPSKSGVSGAILGIVPGKCGICTYSPRLDESGNSIRGKNLLKILSNDLNL
NIFL
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgcaatctatttcaaaggttatatcacttataatggctttaaaagataacactatacaa
gatgtatttgaaaaagttggaactgaaccaactaaatacaagtttaattctctaatacca
atagatgacaagccatctaatccattaataaacgctggtgccattacaacagcatcgtta
atagtgggtaaggacgtggacgaaaaattccaaagagttcttaatatggtaaaaaaatta
tcaaatagcgacaagataagcttcctaaaagaggtctatacttctgaaatggaaactact
gatgtcaataagtcaattgcctactacctaaggagcaagaaaattttctcattaaatgct
gatgaagtattggacttatatataagaaattgttccataggaattaatgcaactgaatta
gctaatggtggttcggttctagctaatggtggttctgatcttgtgacaggcgatgaaatg
gtttcaaaagaagcagttaaaattgtccttgcacaaatggcatcctgcggtatgtatgaa
gagagtggcgaatttcttctaaacgtgggaattccatcaaagagtggcgtcagcggagct
atacttggtattgtacctggtaaatgtggaatttgcacttattctccaagacttgatgag
tcaggaaactcaatccgtggcaagaaccttttgaaaatcttgtcaaacgatctaaattta
aacatatttttataa

DBGET integrated database retrieval system