KEGG   Trichomonas vaginalis: TVAG_143290Help
Entry
TVAG_143290       CDS       T01022                                 

Definition
Clan CA, family C19, ubiquitin hydrolase-like cysteine peptidase
Orthology
K11839  
ubiquitin carboxyl-terminal hydrolase 8 [EC:3.1.2.15]
Organism
tva  Trichomonas vaginalis
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:tva00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    TVAG_143290
Enzymes [BR:tva01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     TVAG_143290
Peptidases [BR:tva01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   TVAG_143290
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 614 aa AA seqDB search
MIDQRIKIQEQWKKFPVPEALTKCSVVYLVEISFFKAFTKWIQNITTKKPPKLDNTNIYN
NHNIVYKKDFDVVRKDAWEFLNKNFGPTKEVKKFLVIDPTTNKETVLIEQVRFQILFDDG
EIKKKTCGLYWKAEHVKNQICASLNLNNADYILVNPKTYIEVSSNMSASDMYKLSDTYKF
KKRKMTETLQPNTLNIQVQSSPLTKTFSNRSVDKHLVRPTFEREKHEAPSSPKKDHTALP
PLKREVHEPSAEESNDSGRRSYLLSKLSSNSTIPSKFGPSKYYPKPIGLNNLGNTCYFNA
ATQCIIRVKPLTDFIFSPIFESQLNPSNKKSSKGKIAKAYKDFLLQMSTSSSRMAENPSN
LRSAVISKFRRFANYSQHDSQEYLNALLDGLHEDMNQSFGAGGNKPEIKITGDSNGWDLL
LSKNDSPIVDMFYGEFFANTECPQCGYVSTNREPFLFLTVTIPKVSYGSVNLEDLLSNFS
QDDELDDKNKWKCEKCKKMVRATRRIGILRVADVIIVHLKRFSDEGYFTTKIETEVKYPS
LLNMSRYAKDGHTGFYKLVGAVFHSGGLGGGHYTAAALDQSTNSWYNFNDSSATPISESS
AHSRSAYILFYQKE
NT seq 1845 nt NT seq  +upstreamnt  +downstreamnt
atgattgaccaaaggataaaaattcaagaacaatggaagaagtttccagttccagaggcg
ttaacaaagtgttcggtagtatatttagtcgaaatttcattctttaaagctttcacaaaa
tggattcaaaatataacaacaaaaaagccaccaaaattagataataccaacatttacaac
aatcacaatatagtatacaagaaagattttgatgtagttaggaaagatgcttgggaattt
cttaataaaaatttcggcccaacaaaagaagtcaaaaagtttctagtaatagatcccact
actaataaagaaactgtactaatagagcaagttcgatttcaaattcttttcgacgatgga
gaaattaaaaagaagacatgtggcttatattggaaagctgaacacgttaaaaatcaaatt
tgtgcttctttgaatttaaataacgctgattacattcttgttaatccaaaaacttatatc
gaagtttctagcaatatgtcagcaagcgatatgtataaattatccgatacatacaagttt
aaaaagaggaaaatgactgaaactcttcaaccaaacacattgaatattcaagttcaatca
tctccattaacgaaaactttttctaacagatcagttgataagcatttagttcgtccaaca
tttgaacgtgaaaagcatgaagcaccgtcttctccaaaaaaagatcatactgcattacca
cctctaaagcgtgaagttcatgagccttcagctgaagaaagcaacgattctggtcgtaga
tcatatctattgagcaagctatcatcaaattcaacaattccatcaaaattcggtccatca
aaatattatccaaaaccaattggtcttaataatctaggaaatacctgttactttaatgct
gctacacaatgcatcattagggttaaacctttaacagattttattttttcaccaattttt
gagtcccaactcaatccatcgaacaagaagagctccaaaggaaagattgctaaagcctac
aaagacttccttcttcaaatgtccacttcatcatcaagaatggccgaaaatccttcgaat
ttaagatcggctgttatttcaaaattcagaaggtttgcgaactattcccaacacgattcc
caagaatatcttaatgcattacttgatggcctccatgaagatatgaaccagagttttgga
gccggcggaaacaagccagaaatcaagataacaggagattcaaatggctgggatttatta
ctttcaaaaaatgactctccgattgtagacatgttttacggagagttctttgcaaacacg
gaatgcccacagtgcggatatgtctctacaaacagagagcctttccttttccttactgtt
acaattccaaaagtttcatatggaagtgtaaatttggaagatttgttatcaaatttcagt
caggatgacgaactcgatgacaaaaacaaatggaagtgcgagaagtgcaaaaaaatggtc
cgtgcaacaagaagaatcggtattctcagagttgctgatgtaataatcgttcatttaaag
agattttccgacgaaggttactttacaacaaaaatcgagacagaagtaaaatatccttct
ctactcaatatgtccaggtacgctaaagatggacatacaggattctataaattagttggt
gctgtattccactcaggtggacttggaggaggacattatacagcagctgcattagaccaa
tctacaaactcttggtacaacttcaatgattctagcgctacaccaatatcagagtctagc
gcacattcaaggagtgcgtatattttattctatcaaaaagaataa

DBGET integrated database retrieval system