KEGG   Trichomonas vaginalis: TVAG_157940Help
Entry
TVAG_157940       CDS       T01022                                 

Definition
4-alpha-glucanotransferase family protein
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
tva  Trichomonas vaginalis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tva00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    TVAG_157940
Enzymes [BR:tva01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     TVAG_157940
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 932 aa AA seqDB search
MISATSVNGVIVHFHVRVSTSYGQEVRVCGNIPELGIWDAKKAIKMQFENNLDFWSADIK
LPKSNEDRTIEYKYVIVNDDNSEQWEPEQNHKLVFGAINDDCVINIEDHFHWRDNVLDAF
SRATFVGAINSRENPVQSQPITFKKNGAHIQTFFSTNCPYVRPKQVVRIVGNVPELGNWN
PKNGLVMRDGCFPIWTANKEFAKSSFPFEYKYVIENTEDGTFLWEDCENRVCPAPVSVNE
NLIDYVQDWFICPNKNLFKGMGIYVPLFSLRTNESQGIGSYTDLKKCVDACNKMGASLIQ
LLPINDTTEKGEWCDSYPYRQVSCFALHPVYIDLLAITDKLPAAMKKEILEAKEKFEKYE
QVEYPAVFAFKMKYLKKIFKLEKENFAKNNLDKFLEKTGSWLKPYALFCLLRDEYKTTEF
RKWPKYSTISPAELEKVCKEKKNELLEIYWIQYVADKQFKESYDYATKNHVALKGDLPIG
VNINSVECWAFPQLFRLHMCAGAPPDDFSSDGQNWGFPTYDWEAMEKDGFAWWRSRLTRM
AELYHQLRVDHILGFFRIWEIPRETCVRGLLGHFFPSVPFTRDELNGMGLWDIDRLTKPY
IRWHILCDKFHGDAEYVSHKYFNSKGWNAQDDYYDFKPEFDNEKKVLQALENDKTLSDEK
REHYKYCLFQLIGNVILIEDPENKGLYHMRTEVLKDHVEATKEGPVVYVSSSWNELDEGL
KQRVKEEANKFFYERMTNLWVQKAQPKLNILKNATKMLICGEDLGQITAGIIKAIDESAI
LSLHVQRMSKIPEEDFDDYHKFGYLSVACPSTHDTSSLRGWWEETKATRENFWYNILFRH
DACPETLSPEVQEDILKQNIWSNSMWAIFLLQDITSIFPELRLQSADAERINIPADPNHK
WRYRYPYKLEELIANDKLNSHVMQLVRDSHRI
NT seq 2799 nt NT seq  +upstreamnt  +downstreamnt
atgatctcagcaacatcagtaaatggagtaattgttcattttcatgttagagtatcaaca
tcatacggtcaagaagttcgtgtttgcggaaatattccagaacttggaatttgggacgca
aagaaagccataaagatgcaatttgaaaacaatttagatttctggtcagcagatattaag
ttaccaaaatcaaatgaagaccgtaccattgaatataagtatgttattgttaatgatgac
aatagcgaacaatgggagccagaacagaaccataaactcgtttttggagcaattaatgat
gattgtgtcatcaatattgaagatcacttccactggagagataatgtccttgacgcattc
agccgtgctacatttgttggagccataaactctcgcgaaaacccagttcaaagccagcca
attacattcaagaagaatggagctcacattcagacattcttctctacaaattgcccatac
gttagaccaaaacaggttgtcagaattgtaggcaacgttccagagcttggcaactggaat
ccaaagaatggtctcgtaatgagagatggatgcttcccaatttggacagcaaacaaagag
tttgccaaatcatctttcccattcgagtacaagtacgtcattgaaaacacagaagatgga
acatttttatgggaagactgcgaaaacagagtttgcccagctccagtttcagttaacgaa
aacttaattgattatgttcaggactggttcatctgcccgaacaagaacctcttcaaagga
atgggtatttatgttcccctcttctccctcagaacaaacgaatcacaaggcattggctca
tacacagatcttaagaaatgtgtcgatgcttgcaacaagatgggcgcatctcttatccaa
ttacttccaatcaacgatacaacagaaaagggtgaatggtgtgattcatacccataccgc
caagtctcatgctttgctcttcatccagtttacatcgatctccttgcaattacagacaag
ctcccagctgcaatgaagaaggaaatccttgaagctaaggaaaaattcgagaagtacgaa
caagtagaatatccagctgtttttgctttcaagatgaagtacctcaagaagattttcaaa
cttgagaaagaaaactttgccaagaacaaccttgacaagttcctcgagaaaactggatca
tggctcaaaccatatgctctcttctgcctcctcagagatgaatacaagacaacagaattc
cgtaaatggccaaagtactccacaatttcgccagctgaactcgagaaagtttgcaaggag
aagaagaacgaattactcgagatctactggattcagtatgtagctgacaagcagttcaag
gagtcatacgactatgcaacaaagaaccatgttgcccttaagggtgatctcccaatcggc
gtcaacattaactcagttgaatgctgggcattcccacagctcttcagactccacatgtgt
gctggcgctcctcctgatgacttctcatctgatggacaaaactggggattcccaacatac
gactgggaagccatggagaaagatggattcgcatggtggcgttcaagacttacaagaatg
gctgagctctaccatcaactcagagttgaccacattctcggattcttcagaatttgggaa
ataccacgcgaaacatgcgtcagaggtcttctcggtcatttcttcccatctgttccattt
acacgtgatgaactcaacggaatgggactttgggatatcgacagactcactaaaccatat
atcagatggcatatcttatgtgataaattccacggcgatgccgagtatgtttctcacaaa
tacttcaacagcaaaggctggaatgctcaagatgattactatgatttcaagccagagttc
gataatgagaagaaggttcttcaagctcttgagaatgacaagacactctcagatgaaaag
cgcgagcattacaaatactgcctcttccaactcattggaaacgttattctcattgaagat
ccagaaaacaaaggtctttaccacatgagaactgaagtcctcaaagatcatgttgaagca
acaaaggaaggaccagttgtctacgtttcatcatcatggaacgaactcgatgaaggtctt
aagcagcgtgtcaaggaagaagctaacaaattcttctatgagagaatgaccaacctttgg
gtccagaaagcccaaccaaagctcaacattctcaagaacgcaacaaagatgctcatctgt
ggcgaagatctcggtcaaatcactgctggaattatcaaagcaattgatgaatctgcaatc
ctttctcttcacgttcagagaatgtcaaagattcctgaagaagatttcgatgattaccac
aagtttggttatctctctgttgcttgcccatcaacacatgatacatcatcactccgcgga
tggtgggaagaaacaaaggctacaagagaaaacttctggtataacattctctttagacac
gatgcttgcccagaaacactttctccagaagttcaagaagatatcctcaagcaaaacatc
tggtccaactcaatgtgggccatcttccttcttcaggacatcacatctatcttcccagag
ttaagacttcagtctgcagatgccgaaagaatcaacatcccagccgatccaaatcacaag
tggcgttatcgttatccatacaagcttgaagagcttattgccaacgataagcttaacagc
catgttatgcagcttgttcgcgattcacacagaatataa

DBGET integrated database retrieval system