KEGG   Trichomonas vaginalis: TVAG_161120Help
Entry
TVAG_161120       CDS       T01022                                 

Definition
hypothetical protein
Orthology
K01829  
protein disulfide-isomerase [EC:5.3.4.1]
Organism
tva  Trichomonas vaginalis
Brite
Enzymes [BR:tva01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     TVAG_161120
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 386 aa AA seqDB search
MDKKETTWLIWPHIKNHQKSIMFILLAALGLAHAVDIIDELNDYTFDKYVKHRKNTSTIF
VMFYKNNSPECKKAALAFVEAAESSYGMVQFARANVRNNTHVVNDLKITSYPTFMIFYPG
GTRIYDQKEITAKNLVRFSDRFIPRLAEPVDEYWVPGKEGYEVDSAAILFSQKKYSPTMW
NAISNAYNETYLRIGFCNNENITKEFNVTDVPAIGFLHNKTFTLYNGNKTFLDIFYAIKK
EYPELARPRPPPTPKPKPSDYVTDEGVWKATCKKKKYCILQAKSNKTEDFIKFAEDYVTE
PFKFVSCGETCPFPEMTDGFWVFHTKLDRAMYAEDLEGLKLHLGRFLGGNPKWTNREELL
AEVKAMKGNKTTTENVQTKSESSQEL
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atggataaaaaagaaacgacatggctaatttggccgcatatcaaaaatcatcagaaatct
attatgtttattttacttgctgcgctaggtctcgcacacgccgttgacatcatcgacgag
cttaacgactacacattcgataaatacgtcaagcatcgtaaaaatacttcgacaattttt
gttatgttttataagaataattctccagagtgcaagaaggcagctctcgctttcgttgaa
gctgctgagtcaagctatggtatggtgcagtttgcacgtgctaatgtaagaaataatacg
catgttgtcaatgatttaaagatcacatcatatccaacatttatgatattctatccaggc
ggcacacgcatttacgatcaaaaggagatcacagctaagaatttagtcagattttcagat
cgttttatcccacgccttgcagaaccagtcgatgaatactgggttccaggcaaagaaggc
tacgaagtcgacagtgctgccattctcttctctcagaagaaatattccccaacaatgtgg
aacgcaatcagtaatgcctacaacgaaacatacctccgcatcggcttttgcaacaacgag
aacatcaccaaagagtttaacgttacagacgtcccagccatcggtttccttcacaacaaa
acattcaccctctacaacggcaataagacattcctcgacattttctacgccattaagaag
gaatacccggaacttgcacgtccaagaccaccgccaacaccaaagccaaagccatctgat
tatgttaccgatgaaggcgtttggaaggctacttgcaagaagaagaaatactgtatattg
caagccaagtccaataaaacagaagatttcatcaaattcgcagaagattacgttacagaa
ccattcaaatttgtatcatgcggagaaacatgtccattcccagaaatgaccgatggtttc
tgggtcttccataccaaacttgatagagctatgtacgcagaggaccttgaaggactcaaa
cttcatctcggaagattcctcggaggaaatccgaaatggaccaacagagaggagctcctt
gctgaagttaaagcaatgaagggtaacaaaactacaacagaaaatgtacaaaccaaatct
gagagctcacaagagctttga

  All links  
No link information was found.   
DBGET integrated database retrieval system