KEGG   Trichomonas vaginalis: TVAG_175670Help
Entry
TVAG_175670       CDS       T01022                                 

Definition
glycosyl hydrolase
Orthology
K01177  
beta-amylase [EC:3.2.1.2]
Organism
tva  Trichomonas vaginalis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tva00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    TVAG_175670
Enzymes [BR:tva01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.2  beta-amylase
     TVAG_175670
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 428 aa AA seqDB search
MLSLFASHAQSRANFYVMATLNLLDGNQNFVNQGQFEGYLNRLRDAGVDGIMIDVWWGRT
ERSEGNYVWSGYQRAFDLIKSRNMKIIPVFSFHQCGGNVGDDCAIYLPDFIRNSNKNPFF
YDQDGKVDQEYISIAYDDIAVTPAGRTPLQCYKDWMNSFKQTFNNYLNDGSIVELEIGLG
ACGELRYPSYQAWKGWSYPGCGEFQSYDSEFTKQLQQDAVAAGHSDWGHHPYNVGDWNTQ
PGGSEFWRDGTSNGWSSAYGRWYISWYASKLNTHGDKVLQIAREIFPTTHLSAKISGIHW
WYMTSCHCAEATAGFNNFYDYDGYRDMMAIFKKHNVDVCFTCLEMTAGGNSSNPPYLVGQ
ILNDAKWAGLNFEGENALAVYDWGSYQRCIDWKNKGLKTFTYLRMCDTLVYNNDNYNTFK
GFVQQMHN
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgctaagtctctttgcatcacacgcacagagtcgagccaacttctatgtcatggcgact
cttaaccttttagatggcaaccagaactttgtcaatcaaggacagttcgaaggttatctt
aacaggctccgcgatgccggtgttgatggcatcatgattgatgtctggtggggcagaaca
gagagatccgagggcaactatgtctggtccggctaccagcgcgctttcgatctcatcaaa
tcacgcaacatgaagattattccagttttctcattccaccagtgtggaggcaatgttggt
gatgactgcgccatttatcttccagatttcatcaggaactctaacaagaacccattcttc
tacgaccaggatggcaaagttgaccaagagtacatctccattgcatacgatgacatcgca
gttacaccagctggaagaacaccactccagtgctacaaagattggatgaacagtttcaag
cagacattcaacaactacctcaatgatggctcaattgtcgaacttgagatcggtcttggt
gcatgtggcgaacttcgttatccatcataccaagcatggaaaggctggtcttatccaggc
tgtggtgaattccagtcatatgattctgagtttacaaagcaattacaacaagatgcagtt
gctgctggccattctgactggggtcatcacccatataatgttggtgactggaacacacaa
ccaggaggctccgaattttggcgcgatggcacatccaacggctggtcatccgcatacggc
agatggtacatcagctggtatgcttcaaagctcaatactcacggcgacaaagttctccag
attgcacgtgaaatcttcccaacaacacacctttctgcaaagatttctggcatccattgg
tggtacatgacatcatgccactgcgcagaagccacagcaggattcaacaacttctatgat
tatgatggttacagagacatgatggcaatcttcaagaagcacaatgttgatgtctgcttc
acatgccttgagatgacagctggtggtaatagttctaatccaccataccttgttggccag
atcttgaacgatgctaagtgggcaggtctcaactttgaaggtgagaacgctcttgcagtc
tatgattggggttcatatcagaggtgcattgactggaagaacaaaggcctcaagacattc
acatacctcagaatgtgcgacactcttgtctataacaacgacaactataacacattcaaa
ggctttgtccagcagatgcacaactga

DBGET integrated database retrieval system