KEGG   Trichomonas vaginalis: TVAG_181540Help
Entry
TVAG_181540       CDS       T01022                                 

Definition
Clan CA, family C19, ubiquitin hydrolase-like cysteine peptidase
Orthology
K01072  
ubiquitin thiolesterase [EC:3.1.2.15]
Organism
tva  Trichomonas vaginalis
Brite
Enzymes [BR:tva01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     TVAG_181540
Peptidases [BR:tva01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   TVAG_181540
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 303 aa AA seqDB search
MGPAVPQEYTFIRLANMGSTCYINSVLQSLFNTDMVANFCWHYSDTIKKHGLEKLVDRTP
LYLFSKIYIDSQNAPQNEVYYTPDYFLNALYESTDKFKWNEMGDSHELFLYLLQNFDNSI
NEINSRLGNEKLPLFSSFFMCETSSIASYNGTITDDSKDIVPIIGLNAKTMKDSIYYWEN
GIDIQDLNEGIDINRKLTKFPDVLVLMPRVFTGVSKCMDKMKPEFKITISGQEYSLKSII
VHIGNDLNSGHYICVFEVSERWVYGDDAEMRPLNDTEYHTFFETGYLPGQDTAISYIFFY
ELL
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgggtccggctgttccacaggagtatacatttatacgacttgcaaatatgggcagtaca
tgttacataaacagtgtcttgcaaagtttattcaacacagatatggttgctaacttttgt
tggcattacagcgatacaattaaaaagcatggacttgaaaagttagtagacagaactccg
ctttatttattcagcaaaatttacatagattcgcaaaatgcaccccaaaacgaggtttat
tatacaccagactattttctgaacgcattatacgaatcgactgataaattcaaatggaat
gaaatgggagattcccatgaactctttttgtatctattacaaaattttgataattcaata
aacgagatcaattcgaggctaggcaatgaaaagttaccactattttcctcatttttcatg
tgtgaaacgtcctcaattgcatcatataacggtacaataacagatgattcgaaagacatt
gtaccaatcatcggattgaatgccaaaacaatgaaagactcaatatactactgggaaaat
ggtattgatatccaggatttgaacgaaggaatagatattaatcgtaaacttacaaaattc
ccagatgttttggttctcatgccaagggtattcactggagtgtctaaatgtatggataaa
atgaagccagaatttaagattacgatttccggccaagaatactccctcaaatcaattatc
gttcatatcggcaatgaccttaatagtgggcattatatttgtgtctttgaagtatcagaa
agatgggtttacggtgatgatgcagaaatgagaccattaaacgatacagagtaccataca
ttcttcgaaacaggatatttgccaggtcaggatactgctatatcgtatatcttcttctac
gagcttttataa

DBGET integrated database retrieval system