KEGG   Trichomonas vaginalis: TVAG_181540Help
Entry
TVAG_181540       CDS       T01022                                 

Definition
Clan CA, family C19, ubiquitin hydrolase-like cysteine peptidase
Orthology
K11842  
ubiquitin carboxyl-terminal hydrolase 12/46 [EC:3.4.19.12]
Organism
tva  Trichomonas vaginalis
Brite
Enzymes [BR:tva01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     TVAG_181540
Peptidases [BR:tva01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   TVAG_181540
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 303 aa AA seqDB search
MGPAVPQEYTFIRLANMGSTCYINSVLQSLFNTDMVANFCWHYSDTIKKHGLEKLVDRTP
LYLFSKIYIDSQNAPQNEVYYTPDYFLNALYESTDKFKWNEMGDSHELFLYLLQNFDNSI
NEINSRLGNEKLPLFSSFFMCETSSIASYNGTITDDSKDIVPIIGLNAKTMKDSIYYWEN
GIDIQDLNEGIDINRKLTKFPDVLVLMPRVFTGVSKCMDKMKPEFKITISGQEYSLKSII
VHIGNDLNSGHYICVFEVSERWVYGDDAEMRPLNDTEYHTFFETGYLPGQDTAISYIFFY
ELL
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgggtccggctgttccacaggagtatacatttatacgacttgcaaatatgggcagtaca
tgttacataaacagtgtcttgcaaagtttattcaacacagatatggttgctaacttttgt
tggcattacagcgatacaattaaaaagcatggacttgaaaagttagtagacagaactccg
ctttatttattcagcaaaatttacatagattcgcaaaatgcaccccaaaacgaggtttat
tatacaccagactattttctgaacgcattatacgaatcgactgataaattcaaatggaat
gaaatgggagattcccatgaactctttttgtatctattacaaaattttgataattcaata
aacgagatcaattcgaggctaggcaatgaaaagttaccactattttcctcatttttcatg
tgtgaaacgtcctcaattgcatcatataacggtacaataacagatgattcgaaagacatt
gtaccaatcatcggattgaatgccaaaacaatgaaagactcaatatactactgggaaaat
ggtattgatatccaggatttgaacgaaggaatagatattaatcgtaaacttacaaaattc
ccagatgttttggttctcatgccaagggtattcactggagtgtctaaatgtatggataaa
atgaagccagaatttaagattacgatttccggccaagaatactccctcaaatcaattatc
gttcatatcggcaatgaccttaatagtgggcattatatttgtgtctttgaagtatcagaa
agatgggtttacggtgatgatgcagaaatgagaccattaaacgatacagagtaccataca
ttcttcgaaacaggatatttgccaggtcaggatactgctatatcgtatatcttcttctac
gagcttttataa

DBGET integrated database retrieval system