KEGG   Trichomonas vaginalis: TVAG_196160Help
Entry
TVAG_196160       CDS       T01022                                 

Definition
TPR Domain containing protein
Orthology
K03350  
anaphase-promoting complex subunit 3
Organism
tva  Trichomonas vaginalis
Pathway
Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:tva00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    TVAG_196160
Protein phosphatases and associated proteins [BR:tva01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     TVAG_196160
Ubiquitin system [BR:tva04121]
 Ubiquitin ligases (E3)
  multi subunit Ring-finger type E3
   APC/C
    other subunits
     TVAG_196160
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 494 aa AA seqDB search
MYDNVILLCQEAFALARSAKILTYYAKAYLESNSATQAVLLCKQNINLIWESQELFVIYV
QSLLECGKFTDAEAIIQKSYQNFPEMEEDIKVALKYYTGLICTRTHRHEDASKYYEEAVQ
MNSSIVSIIPKTSDKFQPAKQKNENKNKSHLLTPSQIRERKSIGSKLPIPKKSIPISTQL
LKKPMSIIEMSKKLPSEMQDSILVLLLSAEYYFRCSKYTEAAAIFSRLYEIHPHTVLGVD
IYSTTLWQLKDEKKLNEVSRRALEIAPNKPESWVAAGNLLSIQHNSDAAVQMFQRAAGID
HSCSYPLALAGHELLLLDSLSEASKLFRESIDRNPQEWSAWYGLGSVHFKQDNFGAAQYY
MRKALDANPDSSVLHYVYAMILRKCGNEEEASEHFDLAISLDPSNLVPVFQKGVMAADSG
DPIEALELLNKAESLAPHEPGIAYTKAVIAESLGDTAGAAEMYTNALVFGHPEKKEIHSA
LEKMMDSVINNFLS
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgtatgacaacgtcattcttctttgccaggaagcatttgctcttgcaagaagtgcaaaa
atattaacatattacgcaaaagcatatttagaatcaaattctgcaactcaagctgtttta
ttatgcaagcaaaacatcaacttaatatgggaatcgcaagaattatttgttatttatgta
caatctcttctagaatgtggaaagttcactgatgctgaagctattatacagaaatcatac
cagaatttccctgaaatggaagaagacattaaagttgcattgaaatactatacaggattg
atctgcacgcgtacacatcgccatgaagatgcttcaaaatattacgaggaagctgtacaa
atgaattcatcaattgtttccatcattccaaagacatcagacaaattccaaccagccaaa
caaaagaatgagaataaaaataaatctcatttgttaactccatcccaaatccgtgaaagg
aagtctattggcagcaaactaccaatccctaagaaatcaatcccaatttctacacaactt
ctcaaaaagccaatgagtatcatagaaatgtcaaagaaattaccttcagaaatgcaagat
tccatcttggttctattactatcagcagagtattacttcagatgctctaaatatacagag
gctgcagcgattttctcaagattatatgaaattcatccacatactgttcttggcgttgat
atttactcaacaacattatggcaacttaaagatgagaagaaattgaatgaagtttccaga
agagcacttgaaattgctccaaataaaccagaatcatgggttgcagcaggaaacttgctt
tctatccaacataattcagatgcagcagttcaaatgtttcagagagcagcaggaatcgat
catagttgctcatatccactagctttagctggacatgaattattattacttgattctctt
tcagaagcatccaaattgttcagagaatcaatagataggaatccacaagagtggagtgcc
tggtacggcctcggaagtgttcattttaagcaagataatttcggagccgcccagtattac
atgagaaaggcattagatgccaatccagactcaagtgttcttcattatgtttacgcgatg
atcctcagaaagtgcggaaacgaagaagaagcctcagagcatttcgatctcgcaatttct
cttgatccatccaacttagttcctgttttccagaagggtgtaatggctgctgactcagga
gatccaatagaagcacttgaactccttaacaaagcagaaagtctcgcaccccatgaacca
ggaatcgcttacacaaaagctgtcattgctgaaagtttgggagatactgctggtgcagca
gaaatgtacacaaacgcacttgtattcggccatcctgagaagaaggagattcactcagct
ctcgagaagatgatggatagcgtcatcaataactttttgtcttaa

DBGET integrated database retrieval system