KEGG   Trichomonas vaginalis: TVAG_196160Help
Entry
TVAG_196160       CDS       T01022                                 

Definition
TPR Domain containing protein
Orthology
K03350  
anaphase-promoting complex subunit 3
Organism
tva  Trichomonas vaginalis
Pathway
Ubiquitin mediated proteolysis
Class
Genetic Information Processing; Folding, sorting and degradation; Ubiquitin mediated proteolysis [PATH:tva04120]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 494 aa AA seqDB search
MYDNVILLCQEAFALARSAKILTYYAKAYLESNSATQAVLLCKQNINLIWESQELFVIYV
QSLLECGKFTDAEAIIQKSYQNFPEMEEDIKVALKYYTGLICTRTHRHEDASKYYEEAVQ
MNSSIVSIIPKTSDKFQPAKQKNENKNKSHLLTPSQIRERKSIGSKLPIPKKSIPISTQL
LKKPMSIIEMSKKLPSEMQDSILVLLLSAEYYFRCSKYTEAAAIFSRLYEIHPHTVLGVD
IYSTTLWQLKDEKKLNEVSRRALEIAPNKPESWVAAGNLLSIQHNSDAAVQMFQRAAGID
HSCSYPLALAGHELLLLDSLSEASKLFRESIDRNPQEWSAWYGLGSVHFKQDNFGAAQYY
MRKALDANPDSSVLHYVYAMILRKCGNEEEASEHFDLAISLDPSNLVPVFQKGVMAADSG
DPIEALELLNKAESLAPHEPGIAYTKAVIAESLGDTAGAAEMYTNALVFGHPEKKEIHSA
LEKMMDSVINNFLS
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgtatgacaacgtcattcttctttgccaggaagcatttgctcttgcaagaagtgcaaaa
atattaacatattacgcaaaagcatatttagaatcaaattctgcaactcaagctgtttta
ttatgcaagcaaaacatcaacttaatatgggaatcgcaagaattatttgttatttatgta
caatctcttctagaatgtggaaagttcactgatgctgaagctattatacagaaatcatac
cagaatttccctgaaatggaagaagacattaaagttgcattgaaatactatacaggattg
atctgcacgcgtacacatcgccatgaagatgcttcaaaatattacgaggaagctgtacaa
atgaattcatcaattgtttccatcattccaaagacatcagacaaattccaaccagccaaa
caaaagaatgagaataaaaataaatctcatttgttaactccatcccaaatccgtgaaagg
aagtctattggcagcaaactaccaatccctaagaaatcaatcccaatttctacacaactt
ctcaaaaagccaatgagtatcatagaaatgtcaaagaaattaccttcagaaatgcaagat
tccatcttggttctattactatcagcagagtattacttcagatgctctaaatatacagag
gctgcagcgattttctcaagattatatgaaattcatccacatactgttcttggcgttgat
atttactcaacaacattatggcaacttaaagatgagaagaaattgaatgaagtttccaga
agagcacttgaaattgctccaaataaaccagaatcatgggttgcagcaggaaacttgctt
tctatccaacataattcagatgcagcagttcaaatgtttcagagagcagcaggaatcgat
catagttgctcatatccactagctttagctggacatgaattattattacttgattctctt
tcagaagcatccaaattgttcagagaatcaatagataggaatccacaagagtggagtgcc
tggtacggcctcggaagtgttcattttaagcaagataatttcggagccgcccagtattac
atgagaaaggcattagatgccaatccagactcaagtgttcttcattatgtttacgcgatg
atcctcagaaagtgcggaaacgaagaagaagcctcagagcatttcgatctcgcaatttct
cttgatccatccaacttagttcctgttttccagaagggtgtaatggctgctgactcagga
gatccaatagaagcacttgaactccttaacaaagcagaaagtctcgcaccccatgaacca
ggaatcgcttacacaaaagctgtcattgctgaaagtttgggagatactgctggtgcagca
gaaatgtacacaaacgcacttgtattcggccatcctgagaagaaggagattcactcagct
ctcgagaagatgatggatagcgtcatcaataactttttgtcttaa

DBGET integrated database retrieval system