KEGG   Trichomonas vaginalis: TVAG_203590Help
Entry
TVAG_203590       CDS       T01022                                 

Definition
(RefSeq) threonine synthase family protein
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
tva  Trichomonas vaginalis
Pathway
tva00260  Glycine, serine and threonine metabolism
tva00750  Vitamin B6 metabolism
tva01100  Metabolic pathways
tva01110  Biosynthesis of secondary metabolites
tva01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tva00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TVAG_203590
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    TVAG_203590
Enzymes [BR:tva01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     TVAG_203590
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PALP ACP_syn_III_C
Motif
Other DBs
NCBI-GeneID: 4761900
NCBI-ProteinID: XP_001316278
UniProt: A2ETD5
AA seq 429 aa AA seqDB search
MFLTGFQSVLSGKQFKVGEREYIAEEEGPKGLLNSTYDFEALKKSLPGSLLSPTLGMFRY
MPFLPIDPKDQLPNVQVGGTPLIPVPQDRSPFKIQLWIKDEGREPTASLKDRASALVCVK
AKELGKTVVTTASSGNAAAATSCMCACLGLKPVIFVPAHAPPAKVLQNRLYGATVFLVEG
VYDRAVEAAMGAAKKYSWYNRSTGFNPYTIDGKKTVSFEICEQLGGILCPEETKGECSWG
KLGKFVAPDAIVVSVGDGNIISGVHKGLKELFAAGLIEKVPKIIGVQAEGSNSVYVCWSQ
KIDPVNMPVCEGSTLADSISCPTPNDPIRAFRAATETNGAYVQVTDEEILAAIPTMARAT
GIFPEPAAAAGFAGIFKAEQQGYLKPGEKVVMISTGNGLKDINNATKSMEGKNVATLIKT
YEDIDGSKI
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgtttcttacaggatttcaatctgttctttctggtaaacaattcaaagtaggtgagcgc
gaatacattgccgaagaagaaggtccaaagggtcttcttaactcaacatacgatttcgaa
gcacttaagaagtcacttccaggttctcttcttagcccaacattaggtatgttccgttac
atgcctttcttaccaattgatccaaaagatcagcttccaaacgttcaagttggtggaact
ccactcattccagtcccacaagacagatctccattcaagatccagctctggatcaaagat
gaaggcagagagccaacagcttctcttaaggatcgtgcatccgcccttgtttgcgtcaaa
gccaaagaattaggcaaaacagtcgttacaacagcctcatccggcaatgcggcagctgca
acatcatgcatgtgcgcatgccttggccttaaaccagtcattttcgtcccagcccacgct
ccaccggccaaagttcttcaaaacagactttacggcgccacagtcttccttgtcgaaggc
gtttacgacagagctgtcgaagcagccatgggagctgccaagaagtacagctggtacaac
cgttccactggattcaatccatatacaattgatggcaagaagacagtttcatttgaaatc
tgcgaacagcttggtggcattctctgcccagaagaaacaaagggcgaatgctcttggggc
aaactcggcaaatttgtcgctccagatgcaattgttgtttccgttggtgatggcaacatc
atttctggtgtccacaagggccttaaggagctctttgctgccggacttatcgaaaaagtt
ccaaagattatcggtgttcaagcagaaggttccaattccgtttacgtatgctggtcccag
aagattgacccagttaacatgccagtttgcgagggatctacacttgctgactctatttcc
tgcccaacaccaaatgatccaatcagagccttcagagctgccacagagacaaacggtgct
tacgtacaggttacagacgaggaaatccttgctgcaatcccaacaatggcccgcgcaaca
ggaatcttcccagaaccggccgcagctgctggattcgctggcatcttcaaggctgagcaa
cagggatatctcaagccaggagagaaagtcgtcatgatttcaacaggaaacggtctcaag
gatatcaacaacgcaacaaagtcaatggaaggaaagaatgtcgcaacactcatcaagact
tacgaggatatcgatggatcaaagatttaa

DBGET integrated database retrieval system