KEGG   Trichomonas vaginalis: TVAG_203590Help
Entry
TVAG_203590       CDS       T01022                                 

Definition
threonine synthase family protein
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
tva  Trichomonas vaginalis
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:tva01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:tva00260]
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism [PATH:tva00750]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 429 aa AA seqDB search
MFLTGFQSVLSGKQFKVGEREYIAEEEGPKGLLNSTYDFEALKKSLPGSLLSPTLGMFRY
MPFLPIDPKDQLPNVQVGGTPLIPVPQDRSPFKIQLWIKDEGREPTASLKDRASALVCVK
AKELGKTVVTTASSGNAAAATSCMCACLGLKPVIFVPAHAPPAKVLQNRLYGATVFLVEG
VYDRAVEAAMGAAKKYSWYNRSTGFNPYTIDGKKTVSFEICEQLGGILCPEETKGECSWG
KLGKFVAPDAIVVSVGDGNIISGVHKGLKELFAAGLIEKVPKIIGVQAEGSNSVYVCWSQ
KIDPVNMPVCEGSTLADSISCPTPNDPIRAFRAATETNGAYVQVTDEEILAAIPTMARAT
GIFPEPAAAAGFAGIFKAEQQGYLKPGEKVVMISTGNGLKDINNATKSMEGKNVATLIKT
YEDIDGSKI
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgtttcttacaggatttcaatctgttctttctggtaaacaattcaaagtaggtgagcgc
gaatacattgccgaagaagaaggtccaaagggtcttcttaactcaacatacgatttcgaa
gcacttaagaagtcacttccaggttctcttcttagcccaacattaggtatgttccgttac
atgcctttcttaccaattgatccaaaagatcagcttccaaacgttcaagttggtggaact
ccactcattccagtcccacaagacagatctccattcaagatccagctctggatcaaagat
gaaggcagagagccaacagcttctcttaaggatcgtgcatccgcccttgtttgcgtcaaa
gccaaagaattaggcaaaacagtcgttacaacagcctcatccggcaatgcggcagctgca
acatcatgcatgtgcgcatgccttggccttaaaccagtcattttcgtcccagcccacgct
ccaccggccaaagttcttcaaaacagactttacggcgccacagtcttccttgtcgaaggc
gtttacgacagagctgtcgaagcagccatgggagctgccaagaagtacagctggtacaac
cgttccactggattcaatccatatacaattgatggcaagaagacagtttcatttgaaatc
tgcgaacagcttggtggcattctctgcccagaagaaacaaagggcgaatgctcttggggc
aaactcggcaaatttgtcgctccagatgcaattgttgtttccgttggtgatggcaacatc
atttctggtgtccacaagggccttaaggagctctttgctgccggacttatcgaaaaagtt
ccaaagattatcggtgttcaagcagaaggttccaattccgtttacgtatgctggtcccag
aagattgacccagttaacatgccagtttgcgagggatctacacttgctgactctatttcc
tgcccaacaccaaatgatccaatcagagccttcagagctgccacagagacaaacggtgct
tacgtacaggttacagacgaggaaatccttgctgcaatcccaacaatggcccgcgcaaca
ggaatcttcccagaaccggccgcagctgctggattcgctggcatcttcaaggctgagcaa
cagggatatctcaagccaggagagaaagtcgtcatgatttcaacaggaaacggtctcaag
gatatcaacaacgcaacaaagtcaatggaaggaaagaatgtcgcaacactcatcaagact
tacgaggatatcgatggatcaaagatttaa

DBGET integrated database retrieval system