KEGG   Trichomonas vaginalis: TVAG_203590Help
Entry
TVAG_203590       CDS       T01022                                 

Definition
threonine synthase family protein
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
tva  Trichomonas vaginalis
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tva00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    TVAG_203590
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TVAG_203590
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    TVAG_203590
Enzymes [BR:tva01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     TVAG_203590
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 429 aa AA seqDB search
MFLTGFQSVLSGKQFKVGEREYIAEEEGPKGLLNSTYDFEALKKSLPGSLLSPTLGMFRY
MPFLPIDPKDQLPNVQVGGTPLIPVPQDRSPFKIQLWIKDEGREPTASLKDRASALVCVK
AKELGKTVVTTASSGNAAAATSCMCACLGLKPVIFVPAHAPPAKVLQNRLYGATVFLVEG
VYDRAVEAAMGAAKKYSWYNRSTGFNPYTIDGKKTVSFEICEQLGGILCPEETKGECSWG
KLGKFVAPDAIVVSVGDGNIISGVHKGLKELFAAGLIEKVPKIIGVQAEGSNSVYVCWSQ
KIDPVNMPVCEGSTLADSISCPTPNDPIRAFRAATETNGAYVQVTDEEILAAIPTMARAT
GIFPEPAAAAGFAGIFKAEQQGYLKPGEKVVMISTGNGLKDINNATKSMEGKNVATLIKT
YEDIDGSKI
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgtttcttacaggatttcaatctgttctttctggtaaacaattcaaagtaggtgagcgc
gaatacattgccgaagaagaaggtccaaagggtcttcttaactcaacatacgatttcgaa
gcacttaagaagtcacttccaggttctcttcttagcccaacattaggtatgttccgttac
atgcctttcttaccaattgatccaaaagatcagcttccaaacgttcaagttggtggaact
ccactcattccagtcccacaagacagatctccattcaagatccagctctggatcaaagat
gaaggcagagagccaacagcttctcttaaggatcgtgcatccgcccttgtttgcgtcaaa
gccaaagaattaggcaaaacagtcgttacaacagcctcatccggcaatgcggcagctgca
acatcatgcatgtgcgcatgccttggccttaaaccagtcattttcgtcccagcccacgct
ccaccggccaaagttcttcaaaacagactttacggcgccacagtcttccttgtcgaaggc
gtttacgacagagctgtcgaagcagccatgggagctgccaagaagtacagctggtacaac
cgttccactggattcaatccatatacaattgatggcaagaagacagtttcatttgaaatc
tgcgaacagcttggtggcattctctgcccagaagaaacaaagggcgaatgctcttggggc
aaactcggcaaatttgtcgctccagatgcaattgttgtttccgttggtgatggcaacatc
atttctggtgtccacaagggccttaaggagctctttgctgccggacttatcgaaaaagtt
ccaaagattatcggtgttcaagcagaaggttccaattccgtttacgtatgctggtcccag
aagattgacccagttaacatgccagtttgcgagggatctacacttgctgactctatttcc
tgcccaacaccaaatgatccaatcagagccttcagagctgccacagagacaaacggtgct
tacgtacaggttacagacgaggaaatccttgctgcaatcccaacaatggcccgcgcaaca
ggaatcttcccagaaccggccgcagctgctggattcgctggcatcttcaaggctgagcaa
cagggatatctcaagccaggagagaaagtcgtcatgatttcaacaggaaacggtctcaag
gatatcaacaacgcaacaaagtcaatggaaggaaagaatgtcgcaacactcatcaagact
tacgaggatatcgatggatcaaagatttaa

DBGET integrated database retrieval system