KEGG   Trichomonas vaginalis: TVAG_212420Help
Entry
TVAG_212420       CDS       T01022                                 

Definition
hypothetical protein
Orthology
K03144  
transcription initiation factor TFIIH subunit 4
Organism
tva  Trichomonas vaginalis
Pathway
Basal transcription factors
Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:tva00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    TVAG_212420
  Replication and repair
   03420 Nucleotide excision repair
    TVAG_212420
Transcription machinery [BR:tva03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     TVAG_212420
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 460 aa AA seqDB search
MEELFKYIRKQPEDFVINLISDQDACRTYIRLLPPLSQQILFRLLYIERGFPRSEVEKWS
PKSKSNDLINAIKKLIKAHLVYIVTDTISENSYNSSIIINKRVREVLLGTYVEDKKAFVR
QKNPFAPDDQPDENFVPFDELDQSKFPTIDEKILDDFSNYQLESILSFMLKLRDNIDNEA
KKILSDAKLMEFGGNLCPKGHRFLLLSPKEQIWRIVKCYLKFTKDLHSSLRFLLKIGSME
LSKGYPITSLTPTQKELLSPFKTIGLVYIDGDYFYPTKSILNFFGKSNIFQTEGWMLIDT
NFKITAFPKSPLHTALLKKFANVTYEFPGFASAFISPNSFREALNQGTTLDDIIGFLKSN
LSHKIGSGQIPSAVMKQFYVWRDQRERLTVTHECIMRQYTNPNDANLAAQCAKQLAGYVY
GPAEKKESHYWIVITLSSIEQSYKPYLDMIQNNSENGGYI
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atggaagaactatttaaatatattcgcaagcagccagaagattttgtaatcaatctcatt
tctgaccaggatgcatgcagaacgtatattagattgcttcctccattatctcaacaaatt
ctttttagacttctttatattgagcgcggatttccacgatctgaagtagaaaaatggtca
cccaagtcaaaatcaaacgacttaataaatgcaattaaaaaattaattaaagcacattta
gtttacattgtaacagacactatctcagaaaacagctataacagctcgattattattaac
aaaagagttcgtgaagttttacttggtacatatgttgaagataaaaaagcatttgtacgc
cagaaaaatccatttgctccagatgaccaaccagatgaaaatttcgttccatttgatgaa
ctagaccaatcaaagttcccaacaatcgatgaaaaaatccttgatgacttctcaaactat
caattagaatctattttaagttttatgttgaaattacgcgacaacatcgataatgaagca
aagaagatcttatcagatgccaagctcatggaatttggaggaaatctttgtccaaaaggt
cacagatttttacttttgtctccaaaggagcaaatttggagaattgttaaatgctatctc
aaattcaccaaggatttgcacagctcactcagattccttctaaaaataggttccatggaa
ttatcgaaaggatatccaattacgagtttgacgccaactcagaaagaacttctgagtcca
ttcaagactatcgggcttgtttacatcgatggagattacttctatccaacaaaatcaatt
ctaaacttctttggcaaatccaacatttttcaaacggaaggatggatgcttatcgataca
aacttcaagattacagcatttccaaagagtccattacatacagctcttcttaaaaagttc
gcaaacgtaacttacgaatttccaggttttgcatcagctttcatttctcctaacagcttc
agagaagccttaaaccaaggtactacacttgatgatatcattggattcctcaaatccaat
ctttcccacaaaattggatccggccaaattccgtctgccgttatgaagcagttttacgta
tggagagaccaaagagagaggctcacagtcactcatgagtgcatcatgaggcagtatacc
aatccaaatgatgcaaatttggccgcacaatgtgcaaagcaattggctggatatgtatac
ggtcccgctgaaaagaaggagagccattactggattgtcataactctgagctcaattgaa
cagagttacaaaccttatcttgatatgattcaaaataattccgaaaatggcggatatata
taa

DBGET integrated database retrieval system