KEGG   Trichomonas vaginalis: TVAG_226870Help
Entry
TVAG_226870       CDS       T01022                                 

Definition
4-alpha-glucanotransferase family protein
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
tva  Trichomonas vaginalis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:tva00500]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1035 aa AA seqDB search
MEGSFEITFYLKCEKGGSSIPYIIGDHPALGNNVLKEAIPLTQINGPYNYSVKIELEEPL
TEPITYRYFFKTQFGAILKETIPLRTLPLFETDAHIYDTFNVTNSLNGVLIRLRTRVFTH
YGQELYVSGNIPELGEWKSENAVPLFFEGNLDYWSTTFMIPLSSKPRTIEYKYIVSRTGG
VDHWEPEENHKLEIGATPSPTIIEIADTYRWKDSVMDAFTRATFKEVLNRRTNTTMPAPI
EPELVRPTYVKTYFQVNCPYVRSTQSVVVVGSIPELGEWNPLHGLKLDDGKFPIWANSID
LKATSFPFDYKYVLSNNDGTFIWEEPMNRECVGPTATQYDNSTPMTYFINEWFACPNKEL
FKGLGVYVPIFSLRTQQSQGIGSYTDIKKLVDICNTMGASLIQLLPINDTTDKGEWADSY
PYKQVSCFALHPVYIDLLAILDKLPSDIYNDLMYRKGELERLPSVDYPAVYSFKMNILSR
IFKLVKEDFKESKEFEAFLKKNGTWLKPYALFCYLRDQYHTMEFRKWPKYSKVTPEEIED
LCDEEINDLLFIYWMQYIADKQFKESYDYATNHKVALKGDLPIGVNINSVECWAFPSLFR
LTMCAGAPPDDFSSDGQNWGFPTYNWEEMEKDGFAWWRARLQRMAELYHTLRVDHILGFF
RIWEIPRETCVRGLLGHFFPSNPLTRQELIQMGLWDIERYTKPYIRGKHLMEKFPNNYFE
IAQKYLIARNISKDNDTYNFKPEYNNEKKIYNAVMNEPLNDWQKKELLQKLFELLGNVLL
IEDPERPDTYHVRTEVKKESVETTPDGPIIHWSTSWLELPGDQRQRFEELYIDYTDRRQT
NLWVAKADAKLGVLKDSTNMLICGEDLGQITAGIIRSIEEHALLSLRVQRMSKDPAYDFD
DYNRFAYLSVACPSTHDTSSLRGWWEENSSIRQKFWYNVLMRHDSCPERLSTYFQEMILR
QNLWSNSMWAIFLLQDLTGINESLRRQSPEEERINIPADPNHKWRYRYPYSLEELNDHKE
FMAQMRGLVEASHRI
NT seq 3108 nt NT seq  +upstreamnt  +downstreamnt
atggaaggctctttcgaaataactttctatctgaagtgcgagaagggtggtagtagtata
ccatatatcattggcgaccatcctgcacttggaaataacgtattaaaagaagcaattcct
ttaacacaaataaatggaccatacaattactctgttaagatagaattggaggagccatta
acagaaccaataacataccgttatttcttcaagacacagttcggagcaattcttaaagaa
acaattccacttcgtacattacctctttttgaaacagatgctcacatctacgacacattt
aatgttaccaattctctaaatggtgtccttatccgccttcgaacacgtgttttcactcat
tacggacaagaactttatgtctcaggcaatatcccagagcttggagaatggaagtccgag
aacgctgttcctctcttctttgaaggcaatcttgactactggtcaacaactttcatgatt
ccattgtcatccaagccaagaacaattgaatacaagtacattgtctcaagaacaggtggt
gttgatcactgggaaccagaagaaaaccacaagctcgaaatcggtgctactccttcccca
acaattatcgaaattgccgatacatatcgttggaaggattcagtcatggacgcattcact
cgtgcaaccttcaaagaggttcttaatcgtcgcactaacactacaatgccagcgcctatc
gagccagagcttgttcgtccaacatatgtgaagacatatttccaagtcaactgtccatac
gttcgtagtacacaatccgttgttgtcgttggctccattccagaacttggtgaatggaat
ccattacacggcttaaaactcgacgacggcaagttcccaatctgggcaaactctattgac
ttgaaggccacatcattcccattcgattacaagtacgtcctttctaataatgacggaaca
tttatttgggaagagccaatgaacagagaatgcgttggaccaacagctactcagtatgat
aactcaacaccaatgacatacttcatcaacgagtggttcgcatgtccaaataaagaatta
ttcaaaggactcggagtttacgttccaatcttctctctcaggacacaacaatcacaaggt
attggttcctacacagatatcaagaaactcgtcgatatttgcaacacaatgggcgcatct
ttgatccaattacttccaatcaacgatacaacggacaaaggagaatgggcagactcatat
ccatacaaacaagtctcatgtttcgcattacatcctgtttacatcgacttacttgcaatt
ctcgacaaattaccaagcgacatctacaatgacttgatgtacaggaaaggggaactcgag
agattaccatctgttgactatccagcagtttattccttcaagatgaacattcttagtaga
atcttcaaattagttaaagaagatttcaaagaatccaaagaattcgaagcatttttgaag
aagaatggaacatggttaaaaccatatgctttgttctgttatctcagagatcaataccat
acaatggagttcaggaaatggccaaaatattccaaagtaactccagaagaaatcgaagat
ctctgtgatgaagaaatcaatgatttattgttcatttattggatgcaatacattgctgac
aaacaattcaaggaatcatatgattacgcaacaaatcacaaagttgcattgaaaggagat
cttccaattggtgtcaacatcaattccgttgaatgctgggcatttccatcattattcaga
ttgacaatgtgtgcaggagctcctccagatgatttctcaagcgatggacagaactggggc
ttcccaacatacaactgggaagagatggagaaggatggattcgcatggtggcgtgcgaga
ttacagagaatggctgaattgtatcatacattgagagttgatcatatcttaggtttcttc
agaatctgggaaattcctagagaaacatgtgtcagaggtttattgggacatttcttccca
agtaatccattgacaagacaggaattgatacagatgggattatgggatatcgaaagatat
actaaaccatacataagaggaaaacatttaatggagaaattccctaacaattatttcgaa
atcgctcagaaatatttaatcgcaagaaatatttctaaagataatgatacttacaatttc
aagcctgaatataacaacgaaaagaagatttacaacgctgtaatgaatgagccattaaat
gattggcaaaagaaggaattacttcagaagttgtttgaattacttggaaatgttttgttg
attgaagatccagaaagaccagatacttatcacgtgagaacagaagtaaagaaggaatct
gttgaaacaacaccagatggaccaatcatccattggagtacatcatggttggaattacct
ggtgaccagagacagagattcgaagaactttatatcgattacacagacagaagacaaaca
aatctctgggttgctaaagctgatgcaaaacttggtgttcttaaagattctacaaatatg
ttgatttgcggtgaagatttaggtcaaatcactgcaggaatcataagatctattgaagaa
cacgctttactttctcttagagtacagagaatgtctaaagatcctgcttatgatttcgat
gattacaacagattcgcttatctttctgtcgcttgcccatcaacacacgacacttcttcg
ttgagaggatggtgggaagagaactcatctatcagacagaagttctggtacaatgtattg
atgagacacgattcatgcccagagagattaagtacttacttccaggaaatgattctcaga
cagaatctttggtcaaattcaatgtgggcaattttcttgctccaggatttgacaggaatc
aacgaaagtttgagaagacagtctcctgaagaagaaagaatcaacatccctgctgatcca
aaccacaagtggagatacagatatccttactcccttgaagaactcaacgaccacaaggag
ttcatggcacagatgagaggcttagttgaggcttctcacagaatataa

DBGET integrated database retrieval system