KEGG   Trichomonas vaginalis: TVAG_233420Help
Entry
TVAG_233420       CDS       T01022                                 

Definition
MOZ/SAS family protein
Orthology
K11308  
histone acetyltransferase MYST1 [EC:2.3.1.48]
Organism
tva  Trichomonas vaginalis
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 375 aa AA seqDB search
MDLTKGDIVSAFCEELQTYLKGEVVTSRQTAKGQQVYVHFFKQDKRLDKWYDIDQLEKTD
LDSEELKESKLNSYSQFGAAYEDFEKLHDQVTKIRNIDLVTIGKYTIKTWYYSPYPDEFN
QLDHIFVCDKCFRYFKTQEELDSHMQGERPYPPGKEIYRNENISIFELKGNSQKLSCQCL
CLLSKLFLDHKTLYYDVEGFNLYVLCELGDDDQVHIAGYFSKELDSSDNNILACITILPP
YQKKGYGFLLISLAYEIARREGKVGGPERPLSDLGKIAFSSYWREVIISTLKDKLTEIKY
ISDIVKLTYIDEDDVVDTLKPLNLVESYRGEYELLESKDDILNIIDKIPTKRMIYAVDAK
KLIWLPSELIHPNSQ
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atggatcttacaaaaggtgatattgtttcagctttctgtgaagaattgcaaacatatttg
aaaggagaagtagtaacatcacgacaaacagcaaaaggtcagcaagtttacgttcatttt
ttcaagcaggataaaagattagataaatggtatgacattgatcaacttgaaaagacagat
ctcgatagtgaagaactaaaagaatcgaaacttaacagttattctcagtttggagcagca
tatgaagatttcgaaaaattacatgaccaagtaacaaaaatacgcaatatagatctagtt
acaattggaaaatatacaataaagacatggtattactctccatatcctgacgaattcaat
caattagatcatatttttgtttgcgataaatgttttcgatattttaagacacaggaagaa
cttgactcccatatgcaaggagaacgcccatatccaccaggaaaagaaatttacagaaac
gaaaatatttcaattttcgaactgaaaggaaattctcaaaaactttcttgccaatgcctc
tgcttactatctaaactcttcctcgaccataaaacgctttattacgatgtagaaggcttt
aatttatacgtattgtgcgaacttggcgacgacgaccaagttcacatagcaggctatttc
tccaaagaactggatagctcagataacaatattttagcttgcattacaattttacctcca
tatcagaaaaaaggctacggattcttacttatatcccttgcctacgaaatagcaagacgc
gaaggtaaagttggtggtcctgagaggcctttgtcagatctcggcaaaattgccttttct
tcttactggagagaggtaattatatcgacattgaaggacaaactcacagagatcaagtat
atcagcgatattgtcaaacttacttatatagatgaagatgatgttgttgatacactaaaa
ccattgaatttagttgaatcttacagaggtgaatacgaacttcttgagtcaaaggatgat
atcctcaatattatcgacaaaataccaacaaaaagaatgatttacgctgttgatgcaaag
aaattgatttggttgccaagcgaactcattcatccaaacagccaatag

DBGET integrated database retrieval system