KEGG   Trichomonas vaginalis: TVAG_235060Help
Entry
TVAG_235060       CDS       T01022                                 

Definition
PIKK family atypical protein kinase
Orthology
K07203  
FKBP12-rapamycin complex-associated protein
Organism
tva  Trichomonas vaginalis
Brite
Protein kinases [BR:tva01001]
 Serine/threonine protein kinases: Atypical group
  PIKK family [OT]
   TVAG_235060
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 2171 aa AA seqDB search
MVQNYMGDMDSTMFMMSTNSFQNFYEKQFMQDGNLGNNQYKIDEALSAISFQQLNNPALT
MILTNILTQSKDTDKTYKANRICRDLQAISPEKNALVWDLFEKIIVWAANSLKASFSLVL
EVFLSKCLSWMTENNSYQRYAGYRLFSTLFKFFPASLESNINHYRTLITKFFKSDETEYY
PVVLDALRTLMDYDKTTHNEVIQLLCKPFKSGKAVKFPGVCIALWMILERYPDDKIHFSI
SSLPMDTFFGKELNLKLATVPALPILIRVAPDLFTDELINNIFKTFEPLLKKKAIMRNEV
LLDFSRFIFFGGIKKDDDIISNIKKCRKEIYEAVDSPEAAAALLACDIYCQDFITADTNR
IYSQLHSLILSSSLKCFLEVCPSFSDTVYRNVLIFGNDILLNISSPPDKIAALFNVFVDL
NIPSSNLSPALILEYSNHLSSQSKEVRLTCFRYLLKYNNDNPSTEVMHRIFTSISTEQDK
ETRLEILSNVNVKVADNAIILAIQQLLHDLDSSVRRLSFEIMVKLANYEAVPPILSSILS
ERLKYLQNAPEILKENILPFSVVANAAFSEPPQVYSANCRQVFVPFSQFLTKFLLSSKKR
LDSVSLQLLTHLVTNLSDEINIDLLVQHIEASLLPHSSMGRLSAALNLMYAALKFTTLRH
NLIEDHSSLLAKYMTITNMPKTAVDRKVLLKVLGLIGAPKPSLVINWLKKKEKTESSNTV
TSPNIFISKSASNDPDQSLLVASIGIGLINILDILGDESLASLHSYAIDSLIKFLKVNRS
LEEDFESLLMMRVNALLQSRGTSTTSVLLSNMATLVTSLGARFKPLVPQVIDLICEQWGK
IDPVTFTRTTEWLAISLPKVFVNYLPRIALLFTKDFAILQPKAVHTILSCLVSFGTLLNQ
VDHIIIPPILSWLLDNAMSTTDVMQTLIRFKQICILAGGAKFAGPIFSTLISVVKANKDV
HNQCLEILFVIACQMGTQFAFHKSYLQEVFDFSKHQDLSIVAVLSEIGTNFPQSILDKVS
PQNSKISRSVSTPKNQLSNTSKLEKLPDFTIPSANYSESNWITWYNEISSICFNESPSKS
ICACISLAERHAPVHDSLFPISFAIYYFAAEVKQDDKIQQIMKTVFKSTSTPRHILKHFL
DVIELIEVVGANIPIPIQILKTRAQGVNNTAQALRFAEKLFDEGDEEVSEDLIVLNQMLG
LPLAANGILRCSKARANNQQEGELSEKLGLWNDALQMYDEKLKEDPNNQRYIIGRLTCLN
ELARYKDLMEAVKDDPRNTYFIGSAAYNLFDDQTFMSVAKDISPRSRIPNDLFFALIYAI
KTKNFENALDILARLQAAKVDKVFPMIYEDYERAYEDTSMVSITQELYEVIQYMQAADRA
IQPNPSEQSLAKKTMERIKNRWRYRFKFLPDRPNVLFQHIRVQSLVLPYEGLRAQYLSYL
DCAIRHGESHISLLESTLEVLMGTAPDDTDLRYDAARLLWLKGNKALAYIHLEGITREGG
DTGMAELTLTKWFMSEGKLQQAAQHIVNAIRFNPNSVDSWNTSSLLFLEYYDATKDERYI
IQAIDQAFNALCFSVDDPLAFTLRILSLLFNHENQGIYDIFEQRISSVPVQVWIDVLPQI
IARASTEDDRLREIIFKLLVSVGREFPHVILSQLMVPYRDDKTIRQKVAAQTFEALTSIY
PDLVRDMMSFTDEMIRVAVTWWEQWFGILDEASRAYLLRNDINEMCELLEPLNEVISKEP
STYFEVSFLAQFGLSLANAHSCIKEYRRTQNEQCVLSAWQTYYSVYQDLKPMINSMSTIL
LADASPILHKFSSKNIIVPGTFSHGKPLVTLSSIAPELTVMKSKQRPRRMIMFGDDGKKY
TFLLKAHEDTRLDERVMQLFGFINTLVEHSDIPMKNHLDITTYKVIPLTTSVGLIGWVQG
CSTVYDQIKQRREKAGIPLELECQTTYKAAPNYEQLPLDDKLFAFKRGLNATKGDDLKIL
LLAQANDSNHWIERRTAYSTSLAMTSMAGYILGLGDRHLCNIMIKQKSAKLVHIDFGDCF
EVAQHREKAPEKVPFRLTRILSNALEVSRIEGTFRSCCENVMNLMRSNSETINGILEVFV
YDPLQQWIEESKDEHGGDAKVIINRIKDKLSGRDFPEKEKLTYQDQVDRLIQEATDANNL
CQMFKGWHPWW
NT seq 6516 nt NT seq  +upstreamnt  +downstreamnt
atggttcaaaactacatgggtgatatggattccaccatgttcatgatgtctacaaactca
ttccaaaatttttatgaaaaacaatttatgcaagacgggaacctaggaaataatcagtat
aagatcgatgaagctctttcagcgatctcatttcaacaactaaataatcccgcgctgacg
atgattcttacaaatatcttaactcagtcaaaggatacagataaaacttacaaagctaac
agaatttgcagagatctccaagcaatatcacctgagaaaaatgcgttggtctgggatctt
ttcgagaagataattgtttgggcagcaaattctttaaaggcgtctttctctttagttctt
gaagttttcctctccaaatgcctgtcttggatgactgaaaacaattcctatcagagatac
gccggctatcgtctatttagcacattatttaaatttttccctgcttctttagagagcaac
atcaaccactaccgcacattaattacaaaattctttaagtctgatgaaactgagtattat
ccagtcgtattagatgctctaagaactttaatggattatgataagaccacgcacaacgaa
gttattcaattgctttgcaagccattcaagtctggcaaagctgtcaaattccctggcgtt
tgcatcgctttatggatgattcttgagagatatccagacgataaaatccattttagcatc
tcttcattgccaatggacacatttttcggaaaagaacttaatcttaagctcgcgaccgta
ccagctctccctattttgattagagttgccccagatttatttacagatgaattaatcaac
aacattttcaagacatttgaacccctactcaagaagaaagctataatgagaaacgaagtc
ctccttgacttctcgcgctttattttctttggcggaatcaaaaaagatgacgatataatt
tccaacatcaagaaatgtcgtaaggaaatttacgaagctgttgatagtcctgaagctgct
gctgcacttcttgcctgcgatatctattgccaggatttcattacagctgatactaacaga
atttacagtcaattgcactctctcatcctttcatcttcacttaaatgcttccttgaagtc
tgtccatcattttcagataccgtttatcgaaacgtcttaatttttggaaatgatattctt
ctcaacatttcatctccaccagacaaaatcgcagctttgttcaacgtttttgtcgatctc
aacattccttcttcaaatctctcgcctgctctgattttagaatattcaaaccacttaagt
tcgcaatcgaaagaagttagactgacatgcttcagatatttgcttaaatacaataacgat
aatccatcaacggaggtaatgcatcgcatctttacaagtatttctacagaacaagacaaa
gaaactcgtcttgaaatcttatcaaatgttaatgtcaaggttgctgataatgctattatt
cttgcgattcaacaactcttacacgacctcgattcatccgtcagaaggttatctttcgaa
attatggtcaaacttgccaactacgaagctgttcctccaatcctttcttcaatactttca
gaacgtctgaaatatctgcaaaatgctcctgaaattttaaaggagaatattttacctttc
agtgttgttgcgaacgctgcattttctgaacctccacaagtatactctgcaaattgccgt
caagttttcgttcctttctcccaattcttgacgaaatttttattatcctcaaagaaacgc
cttgattctgtttctttacaactccttacccacttagttacaaatttatccgatgaaatt
aatatcgatttacttgtccaacatatcgaagcctcattattacctcactcctcaatggga
cgtctcagtgcagctctaaatctcatgtatgcagcccttaagttcactactcttaggcac
aacctcatagaagaccattccagcttacttgcgaaatacatgacgattacgaacatgcca
aagacagctgtcgatcgtaaagtacttttgaaagtgttaggattgatcggtgctccgaag
ccatccctcgttatcaactggctgaagaagaaagaaaagacagaatcatcaaacacagtc
acttcaccaaacattttcatttcaaaatctgccagcaatgatccagatcaatctttactt
gttgcatctattggtattggtcttatcaacatcttagatatattaggtgatgaatcattg
gcttctttgcactcatatgctattgattctttgatcaaattcctcaaggtcaacagaagt
ctcgaagaagatttcgaatcactcctcatgatgagagttaacgcattgctccagtcaaga
ggtacttcaacaacatctgttttgctctcaaatatggctactttggtcacttcacttggt
gcaagatttaaaccattagttccacaagtcattgatttgatttgcgaacaatggggtaaa
atcgatcctgtaactttcacaagaacaacagaatggcttgccatttctttaccgaaagtt
ttcgtgaattatcttccaagaattgcacttttgttcacaaaagatttcgcaattctccaa
ccaaaggctgttcacacaattctcagctgcttggtatcatttggaacactcctaaaccaa
gttgatcatatcatcatcccaccaatcttgtcatggcttttggataacgcaatgagcaca
acagatgtcatgcagacattaattagattcaagcaaatttgcatcttagcaggaggtgca
aaattcgctggtccaattttctcgacgttgatttctgtcgtgaaagcgaataaagatgtt
cacaaccaatgccttgaaatcttgttcgtcatcgcttgccagatgggaactcaattcgct
ttccacaaatcatatctccaagaagtattcgatttctcgaaacaccaagatttgtcaatt
gtcgctgttttgtctgaaatcggaacaaacttccctcagtcaattttggacaaagtttct
ccacaaaactcaaaaatcagcagaagtgtaagtactccaaagaatcaactctccaacact
tccaaacttgagaaattacctgatttcactattccttcagctaattattcagaatctaac
tggatcacatggtataatgaaatctcttctatctgtttcaacgaatctccttcaaaatca
atctgcgcttgcatttctttggctgaaagacatgctcctgtgcatgattctcttttcccg
atttcctttgccatttactatttcgctgccgaagtcaaacaagacgacaagatccaacag
atcatgaagactgttttcaagtcaacatcaacacctcgtcacatcttgaaacacttctta
gatgtcattgaactcatcgaagttgttggtgcaaacattccaattccaatccaaattctc
aagacacgtgcacaaggtgtaaacaacacagcacaagcattgagatttgctgagaaactc
ttcgatgaaggtgatgaagaagtctcagaagacttgattgtcctcaaccagatgcttggt
cttccacttgctgctaatggtatcttgagatgttctaaagcaagagcaaataaccaacaa
gaaggagaactttcagaaaaacttggtttgtggaatgatgctttacagatgtacgatgaa
aaactcaaagaagatccaaacaaccagagatacatcattggaagattgacatgtctcaac
gaactcgccaggtataaagatctcatggaagctgtcaaagatgatccaagaaacacttat
ttcattggttctgccgcatacaacttgtttgatgatcaaacatttatgagcgttgcaaag
gatatctcaccgagatctcgcataccaaatgatttattcttcgctttgatctatgccatc
aagacaaagaatttcgaaaatgctttggatatcttagctcgtttgcaagcagccaaagtt
gacaaagtctttccaatgatttatgaagattacgaacgtgcttacgaagatacttccatg
gtttcgatcacacaagaattgtacgaagttattcagtacatgcaagctgctgatagggca
attcagcctaatccttctgaacaatcattggccaagaagacaatggaaagaattaagaac
agatggcgttatagattcaaattccttcctgacagaccaaatgttttgttccagcacatc
agagtccaatcattagttcttccttatgaaggtctcagagctcaatacttgagttacttg
gattgcgcaatcagacatggagaatctcacatctcattactcgaatcaacattggaagtt
ttgatgggaacagctcctgatgacactgatctcagatacgatgccgccagattgctttgg
ctcaaaggaaacaaagcattggcttacatccacttagaaggcatcacaagagaaggtgga
gatacaggaatggctgaactaacattaactaaatggttcatgtcagaaggaaagcttcaa
caagcggctcaacacattgttaatgccatcagattcaatccaaattccgttgattcatgg
aacacttcatctcttttgttcttggagtattatgatgcaacaaaagacgagagatacatc
atacaagccattgatcaggctttcaatgctttgtgcttctccgttgatgatcctttggca
tttacattgagaatcttgtctttgttgttcaaccacgaaaaccaaggaatttacgacatc
ttcgagcaaagaatttcttcagttcctgttcaagtgtggatcgatgttttgccacaaatc
atcgccagagcatcaacagaagacgacagacttcgcgagatcatcttcaagctgttagtt
tcagttggaagagagttcccacatgttatcttgtctcagttaatggttccttacagagat
gacaagacaatccgccaaaaagttgcagcccaaacattcgaagcattgacatcaatctat
ccagatttagtcagagacatgatgtcatttacagatgaaatgatcagagttgctgttaca
tggtgggagcagtggttcggcatcttggatgaagcatctcgtgcttatcttttgagaaat
gatataaacgagatgtgcgaattattagaaccactcaatgaagtcatttctaaagagcca
tcaacatatttcgaagtctccttcttagcacagttcggtttgtctttggccaatgcacat
tcctgcatcaaagaatacaggagaactcagaacgaacaatgtgttttatctgcatggcaa
acatactattccgtttaccaggatttgaagccaatgatcaactcaatgtctacaattctt
ctggcagatgcatctccaattctccacaaattctcatcaaagaacatcatcgttcctggc
acattttctcatggaaagcctcttgttactttgtcatccatcgctccagagttaactgtc
atgaaatccaaacagagaccaagaagaatgatcatgtttggcgacgacggaaagaaatac
actttcttgttgaaggcgcacgaagacacaagacttgatgaaagagttatgcagctgttc
ggcttcatcaacactttggttgaacacagtgatattccaatgaagaatcatttggatatc
acaacatacaaagttattcctctcacaacaagtgttggtttgatcggttgggtccaggga
tgctcaacagtttacgatcagatcaaacaaagacgtgaaaaggcaggaattccacttgaa
ctcgaatgccagacaacatacaaggctgcaccaaattacgagcaattgcctcttgatgat
aaattgttcgccttcaagagaggtctcaacgcaactaaaggtgatgatctcaagattctt
ttgctcgcacaagcaaatgattcgaaccattggatcgagagaagaactgcatattctaca
tctcttgcgatgacatcaatggccggttacattttaggtttgggagacagacatctttgc
aacatcatgatcaagcaaaagagtgctaaacttgttcatattgacttcggcgattgcttc
gaagttgcccagcacagagagaaagccccagaaaaggttccattcagattaacaagaatt
ctttcaaacgcccttgaagtatcaagaattgaaggtacattcagatcatgctgcgaaaac
gtcatgaatctaatgagatctaactctgaaacaatcaatggtatccttgaagtttttgtt
tacgatcctcttcaacaatggatagaagaatcaaaggatgaacacggcggtgacgctaaa
gtcatcatcaacagaattaaagataaattgtcaggaagagacttcccagagaaggagaag
ttgacttatcaagaccaagtcgacagattaatccaggaagcaacagatgccaacaatttg
tgtcagatgttcaagggatggcatccatggtggtaa

DBGET integrated database retrieval system