KEGG   Trichomonas vaginalis: TVAG_239910Help
Entry
TVAG_239910       CDS       T01022                                 

Definition
Casein kinase II regulatory subunit family protein
Orthology
K03115  
casein kinase II subunit beta
Organism
tva  Trichomonas vaginalis
Pathway
Ribosome biogenesis in eukaryotes
Brite
KEGG Orthology (KO) [BR:tva00001]
 Genetic Information Processing
  Translation
   03008 Ribosome biogenesis in eukaryotes
    TVAG_239910
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 248 aa AA seqDB search
MTNKDGAPRIIEYDGFRLFGGPCVKCPPSADPWIFQFCNLPQNRWYVAIDIDWVTDWFNQ
YGIRELFENFDEAIELISDQHSEKWKDFTEDKIKQIHVQATRIYGLLHARWITQPKGLYS
MKKKYESGVFGQCPRVLCNGTNLLPMGTSSTLRKHAVKLFCPKCCDIYKAPKTPTIDGAY
FGPAFPHLFLCEFVHFDTSDEFKPFDQKVFGFRVHMTPQSKYRPHISNIQDFDLPQIEDE
SQVQPPQD
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgacgaataaagacggcgctccacggattattgagtacgatgggttccgtctttttggt
ggtccatgtgtgaagtgtcctcctagtgctgatccatggatttttcagttctgtaactta
cctcaaaacaggtggtacgttgcaattgatatagattgggtaaccgattggtttaatcag
tatggcattagagaattatttgaaaactttgatgaagcaatagagttaatttcagatcaa
cactcagaaaaatggaaagatttcactgaagataaaatcaaacagatacatgtgcaagca
acaagaatttacggtcttttacatgcaagatggattacacagccaaagggattgtattca
atgaaaaagaaatacgaatcaggagttttcggtcaatgccctcgagttttgtgtaatgga
acaaatctattgccaatgggtacatcctcaacattgaggaagcatgctgttaagcttttt
tgcccaaaatgttgtgatatttacaaagctcctaaaacaccaacaattgatggtgcttac
ttcggacctgcattcccacatcttttcctttgtgaatttgtccattttgatacatcagat
gaatttaaaccttttgatcagaaagttttcggatttagagttcatatgactcctcaatca
aaatatcgcccacatatttcgaatatacaagacttcgatttacctcaaatagaggatgaa
tctcaagttcagcctcctcaagattaa

DBGET integrated database retrieval system