KEGG   Trichomonas vaginalis: TVAG_243640Help
Entry
TVAG_243640       CDS       T01022                                 

Definition
glutamyl-tRNA synthetase family protein
Orthology
K09698  
nondiscriminating glutamyl-tRNA synthetase [EC:6.1.1.24]
Organism
tva  Trichomonas vaginalis
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Class
Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis [PATH:tva00970]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 491 aa AA seqDB search
MSDIKLRFAPSPTGYLHIGGLRTALYNYLFAKKNGGKFVLRIEDTDRTRYVEGAIENLIE
SLEWAGITHDEGVVVKDGNLTEVGNCGPYIQSQRLDIYKKYVDKLIEDGHAYYCFCSKDR
LDHLREEQRIKGKVPKYDGLCRGIPLEEAKKRVAAGEDYVVRLKLPKNKDITFNDAVRGK
VTINTDEIDDQVLMKSDGFPTYHMAVIVDDHLMGITHIVRGEEWLPSTPKHVYLYECLGW
QPPEFVHLPTVLNKDRKKLSKRQGDVSVEDFKKRGYLPEGLVNYLALVGWSPEDGEEIMS
LDELVEKFSFDRVGKSGGIFDTDKLNWVNSHYMKSYDLEKLSELAIPFVTESGLLNEEEI
RNNFEWYKILIETVREACDKLEDIPRHIEFLFGDIEITEDQAKEELAQEHVPGLLDSFIK
IVKSHDEIEMETAKGLMKEVQKDSGVKGKQLYMPVRAAISGNVHGPEMQNILYLLGKDKL
IERAEKIKDLL
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgtcagatattaaattaagatttgcaccatcaccaacaggttacctccacataggaggt
ttgagaacagctctttacaattacttattcgcaaaaaaaaatggcggcaaatttgtattg
agaatcgaagatacagataggacaagatatgttgaaggtgccatagaaaacctaattgag
tcccttgaatgggcaggcataactcatgacgaaggtgttgtagttaaggacggtaatcta
acagaagttggtaactgtggaccttacatccaatcacaaagattagacatctacaaaaaa
tatgttgataaattaattgaagatggtcacgcatactactgcttctgctccaaggacaga
ctagatcacttgagagaagaacaaagaattaagggaaaagtgcctaagtacgatggactt
tgccgtggaattcctcttgaagaagctaagaagagagttgcagctggcgaagactacgtt
gtaagacttaaacttccaaagaacaaggatatcactttcaatgacgcagttcgtggaaaa
gttacaattaacactgatgaaattgacgaccaagtcctaatgaagtcagatgggttccca
acttaccacatggctgtaatagttgatgaccacctaatgggaatcacacacattgtaaga
ggggaagaatggcttccatcaactccaaaacacgtttatctttatgaatgtcttggctgg
caaccaccagaatttgtccaccttccaacagttttaaataaggacagaaaaaagctttct
aagagacagggagatgtttctgtagaagactttaagaagaggggctacttaccagaagga
cttgtaaactaccttgcacttgttggttggtctccagaagatggagaagaaattatgtcc
ctagacgagttagtagaaaagttctcctttgacagggtaggaaagtctggaggaatcttc
gacacagacaaattgaattgggttaactctcattatatgaagtcctatgacctagaaaaa
ctttctgaacttgctattccttttgtaactgaatcaggcctactaaatgaagaagaaatt
agaaacaactttgaatggtacaagatcttaattgaaacagtgagagaagcctgcgataag
ttagaagacataccaagacacatcgagttcctatttggtgacattgagatcacagaggac
caagctaaggaagagcttgcacaagaacatgtgccaggacttcttgactcctttataaaa
attgtaaaatcacacgatgaaattgaaatggaaactgccaagggactaatgaaggaagtt
caaaaagattctggagtaaagggcaagcaactttacatgccagtaagagctgcaatctca
ggtaatgttcacggaccagaaatgcaaaatatcctatatctattaggcaaggacaagcta
attgaaagagcagaaaaaattaaagatttactttaa

DBGET integrated database retrieval system