KEGG   Trichomonas vaginalis: TVAG_256320Help
Entry
TVAG_256320       CDS       T01022                                 

Definition
Serine/threonine protein phosphatase alpha-1 isoform
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
tva  Trichomonas vaginalis
Pathway
mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:tva00001]
 Genetic Information Processing
  Translation
   03015 mRNA surveillance pathway
    TVAG_256320
Enzymes [BR:tva01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     TVAG_256320
Protein phosphatases and associated proteins [BR:tva01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     TVAG_256320
Transcription machinery [BR:tva03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     TVAG_256320
Spliceosome [BR:tva03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    TVAG_256320
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 329 aa AA seqDB search
MSLKWLDAITDKLLDAGSKPPGTPAGLSLSKIQMLCKEVRKILIDQPILLELQPPLTICG
DIHGQYHDLLRIFDRCKYPPQTNYLFLGDYVDRGVQSIETICLLFSYKIRYPENFFLLRG
NHECSYINREFGFFDECIQQYSVTVWRMFSDVFNCLPLAAIIDDKIFCVHGGISPNLRKL
DDIRALESQRPFEIPEEGLVCDLVWSDPDFETPEWAGNDRGASYVFGVNPLKKFLERFHF
DLVVRGHQAVMGGYDFPFQDEQGIVTLFSAPNYCYEYDNKGATMQVDENLFCSFTVLPPM
KWEEDYFVGPRPGTPPRGTEENGPTELHL
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgtcattgaagtggcttgatgctattacagataaattacttgatgccggctccaaacca
ccaggtacacctgctggtctttcactttcaaaaatacaaatgctttgcaaggaagttcgt
aaaattttaattgatcaaccaatccttctcgagcttcagcctccgcttacaatctgtgga
gatattcatggtcagtatcacgatcttcttcgcatttttgatcgttgcaaatacccacca
caaacaaattacctatttcttggcgattatgttgatagaggtgtccaatccattgaaaca
atatgtttattattctcatacaaaatcagatatccagaaaacttctttttactcagagga
aatcatgaatgttcgtatatcaatcgtgaatttggtttcttcgatgaatgcatacagcaa
tatagcgtcactgtttggcgtatgttttcagatgtgtttaactgcttaccacttgcagcc
attattgatgacaagatcttctgcgttcacggaggtatttcaccaaatcttagaaagctt
gatgatatccgtgcattagaatctcagagaccattcgaaattccagaagaaggtttagta
tgcgacctagtctggtcagatccagatttcgaaacacctgaatgggcaggtaatgataga
ggtgcctcatacgtctttggtgtcaatccgcttaagaaattccttgaaagattccatttc
gatttagttgtaagaggtcatcaagccgttatgggcggatatgacttcccattccaagac
gagcaaggaattgttacattattctctgctccaaactattgttatgaatacgataataaa
ggtgctacaatgcaagtggacgaaaatctcttctgcagcttcactgttttgccaccaatg
aagtgggaagaagactatttcgttggtccacgtccaggtacaccaccaagaggaacagaa
gaaaacggtccaacagaattgcacctctaa

DBGET integrated database retrieval system