KEGG   Trichomonas vaginalis: TVAG_258130Help
Entry
TVAG_258130       CDS       T01022                                 

Definition
CMGC family protein kinase
Orthology
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
tva  Trichomonas vaginalis
Brite
Enzymes [BR:tva01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     TVAG_258130
Protein kinases [BR:tva01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   TVAG_258130
Exosome [BR:tva04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   TVAG_258130
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 360 aa AA seqDB search
MSGDKEVSIEELEYETQHRYQFKRLLGRGAYGVVFAAKDKQTGKLVAVKRVERIFETTLD
AKRCLREVCILSHLKHENITNLIDVTANPDYSKFESLIVVMDLMETDLYQIINSHQPITV
DHHRFFIYQVLRGLKFIHSANVLHRDLKPSNLLVNSNCDLKIGDFGLARISQPDEDSEFL
SEYVATRWYRPPEVLLNYETYGPQLDVWSVGCILAELILRKPLFPGRSTTNQISLIVDII
GSPSEEDLASCPSKNAVRYVKGLGPKPKIPWKQIFRGKQFDDQEIDLVDRMLTWNPDKRI
TVDEALEHPFMEKLHDPTDEPVTFPLDDFEFEREDIKLRELKMRAWNEVLKYHPEFGKPK
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgagcggtgataaagaagtctcgattgaagaactcgagtacgaaacgcaacatcgctac
caattcaaaagattgcttggccgcggtgcttatggtgtagtttttgctgcaaaagataag
caaacgggcaaattagttgcagttaaacgcgttgaacgcatttttgaaacgactttagat
gcgaaacgttgtctccgtgaggtgtgcattctgtcccacttaaaacatgaaaatattaca
aatttaatagatgttactgctaatccagattattccaaattcgagtcattaatcgtagtt
atggatttaatggaaacagatctctatcaaattattaatagccatcaaccaattacagta
gatcaccatagatttttcatttatcaagttttacgcggattgaaatttattcattctgca
aacgttcttcatcgtgatcttaaaccttcaaatcttcttgtaaattcaaattgcgacctc
aagattggcgacttcggtcttgcacgtatcagccaacccgatgaagattccgaattctta
tccgaatatgttgctactcgttggtaccgcccaccagaagtacttttgaactacgaaaca
tacggaccacaacttgatgtttggagtgttggttgtattcttgccgaacttattctccgc
aagcctcttttcccaggccgttcaactactaaccagatttccttaattgttgatataatc
ggaagtccatctgaagaagatttggcctcttgcccttcgaagaatgccgttcgctacgtt
aaaggcctaggacctaagccaaaaatcccctggaagcaaattttcagaggaaagcaattt
gatgaccaagaaatcgatcttgtcgatagaatgcttacatggaatccagataagagaatt
acagtcgatgaagcacttgagcatccattcatggagaaattacacgatcctactgatgaa
ccagttactttcccacttgatgacttcgaatttgaacgtgaagatatcaagttacgcgag
ctaaagatgagagcatggaatgaagttcttaagtatcatccagaattcggaaagcccaaa
taa

DBGET integrated database retrieval system