KEGG   Trichomonas vaginalis: TVAG_258560Help
Entry
TVAG_258560       CDS       T01022                                 

Definition
Ser/Thr protein phosphatase
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
tva  Trichomonas vaginalis
Pathway
mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:tva00001]
 Genetic Information Processing
  Translation
   03015 mRNA surveillance pathway
    TVAG_258560
Enzymes [BR:tva01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     TVAG_258560
Protein phosphatases and associated proteins [BR:tva01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     TVAG_258560
Transcription machinery [BR:tva03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     TVAG_258560
Messenger RNA biogenesis [BR:tva03019]
 Eukaryotic Type
  mRNA processing factors
   3' end processing
    Cleavage and polyadenylation specificity factor (CPSF) complex
     TVAG_258560
Spliceosome [BR:tva03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    TVAG_258560
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 309 aa AA seqDB search
MELDLDDFILAVTACAKKPITQLINESEIIKLCDLVLEVFQSQDILLNLIPPVTVCGDIH
GQFTDLLKIFEKCGSPDEVNYLFLGDYVDRGPSSIATLCLLFAYKCKYPTNFFLLRGNHE
SEAVNKDFGFYRECVESYSKSLWEKSNSTFKYMPVAATINNRILCIHAGISPKLKCIYDI
KQIQRPAEIETDSLLCDLLWADPDNRINYFTANPRGVSVLYGAEAVKNFFNGTDFDLIIR
SHQHVDEGYLAPFNPNMSVLTIFGVPNYMGTVNNKAAMVNISPDMVCTFTVISPPSSRKH
KSKKSKNHK
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atggaacttgatcttgatgatttcattttggctgttactgcatgcgctaaaaagccaatt
acacaactgataaacgaatcggaaattataaaactgtgcgatttagtccttgaagttttt
caatcacaagatattctactaaatttaataccgcccgttacagtttgcggcgatatacat
ggacagtttactgaccttcttaaaattttcgaaaaatgcggttctccagatgaagtcaat
tacttgttcttaggtgattatgtagatagaggtccttctagtattgcgacattatgcttg
ctatttgcttataagtgtaagtaccctacaaacttctttttactcagaggaaatcacgaa
tcagaagctgtaaacaaagatttcggtttttacagagaatgtgttgaaagttacagcaaa
tcactatgggaaaaatccaattctacatttaaatacatgccagttgcagcaacaataaat
aatagaattttatgcattcatgcaggaatatctccaaaattaaaatgcatttatgatata
aaacagatccaaagaccagctgagattgaaaccgactctcttctttgcgatttattatgg
gctgatcctgacaacagaattaactattttactgcgaatcctcgcggcgtttcggttttg
tatggtgccgaagctgtgaaaaatttctttaatgggacggattttgatttaataattaga
tctcatcaacacgttgatgaaggatatttggcaccatttaatccaaatatgtctgttctt
acgatatttggcgtaccaaattatatgggaacagtgaataataaagctgcaatggtcaac
atttctccagacatggtttgcacattcactgttatctcacctccttcgtcaagaaagcac
aaaagtaagaaatcaaagaatcataagtaa

DBGET integrated database retrieval system