KEGG   Trichomonas vaginalis: TVAG_258560Help
Entry
TVAG_258560       CDS       T01022                                 

Definition
Ser/Thr protein phosphatase
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
tva  Trichomonas vaginalis
Pathway
mRNA surveillance pathway
Class
Genetic Information Processing; Translation; mRNA surveillance pathway [PATH:tva03015]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 309 aa AA seqDB search
MELDLDDFILAVTACAKKPITQLINESEIIKLCDLVLEVFQSQDILLNLIPPVTVCGDIH
GQFTDLLKIFEKCGSPDEVNYLFLGDYVDRGPSSIATLCLLFAYKCKYPTNFFLLRGNHE
SEAVNKDFGFYRECVESYSKSLWEKSNSTFKYMPVAATINNRILCIHAGISPKLKCIYDI
KQIQRPAEIETDSLLCDLLWADPDNRINYFTANPRGVSVLYGAEAVKNFFNGTDFDLIIR
SHQHVDEGYLAPFNPNMSVLTIFGVPNYMGTVNNKAAMVNISPDMVCTFTVISPPSSRKH
KSKKSKNHK
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atggaacttgatcttgatgatttcattttggctgttactgcatgcgctaaaaagccaatt
acacaactgataaacgaatcggaaattataaaactgtgcgatttagtccttgaagttttt
caatcacaagatattctactaaatttaataccgcccgttacagtttgcggcgatatacat
ggacagtttactgaccttcttaaaattttcgaaaaatgcggttctccagatgaagtcaat
tacttgttcttaggtgattatgtagatagaggtccttctagtattgcgacattatgcttg
ctatttgcttataagtgtaagtaccctacaaacttctttttactcagaggaaatcacgaa
tcagaagctgtaaacaaagatttcggtttttacagagaatgtgttgaaagttacagcaaa
tcactatgggaaaaatccaattctacatttaaatacatgccagttgcagcaacaataaat
aatagaattttatgcattcatgcaggaatatctccaaaattaaaatgcatttatgatata
aaacagatccaaagaccagctgagattgaaaccgactctcttctttgcgatttattatgg
gctgatcctgacaacagaattaactattttactgcgaatcctcgcggcgtttcggttttg
tatggtgccgaagctgtgaaaaatttctttaatgggacggattttgatttaataattaga
tctcatcaacacgttgatgaaggatatttggcaccatttaatccaaatatgtctgttctt
acgatatttggcgtaccaaattatatgggaacagtgaataataaagctgcaatggtcaac
atttctccagacatggtttgcacattcactgttatctcacctccttcgtcaagaaagcac
aaaagtaagaaatcaaagaatcataagtaa

DBGET integrated database retrieval system