KEGG   Trichomonas vaginalis: TVAG_260190Help
Entry
TVAG_260190       CDS       T01022                                 

Definition
CMGC family protein kinase
Orthology
K08293  
mitogen-activated protein kinase [EC:2.7.11.24]
Organism
tva  Trichomonas vaginalis
Brite
Enzymes [BR:tva01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     TVAG_260190
Protein kinases [BR:tva01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [Table]
   TVAG_260190
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 361 aa AA seqDB search
MDDDNDSSIENLDKQILKRYEIIKKVGKGAYGIVWRAQDRVTGQLVALKKVFGAFQNVID
AQRTYREITLLRQLKSHPFIVGLLQVHRAENDNDIYLAFEFMDTDVHTVIHAGILLDVHQ
RYIFWQLLCALKFIHSAGVIHRDLKPSNMLIKSDSSIKVCDFGLSRCINDMHQDELLTDY
IATRWYRAPEIIFGSSKYGPGIDMWAAGCILAELVSGRPLFPGASTMDQLERVISFTGMP
NKEDIESMQCPMVETMLGNLTFSRPQLVLEERLSGADPDAIDLIKKLCQFNPNKRPTAEQ
CLAHPYLKAFHFESREVSSSVQVKMALSDATKHTIREYRNQIYKEAVSNPDRGLKKKKSD
S
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atggatgatgataacgattcatccattgaaaatcttgataagcaaatacttaaacgatat
gaaatcatcaagaaggtcgggaaaggtgcatatggtattgtttggcgtgcacaagatcga
gtaacaggacaattagttgctttgaaaaaagtatttggtgcatttcaaaacgtaattgat
gcacaacgtacgtatcgtgaaattacacttttgagacaactgaaatcacatcctttcatt
gttggccttttacaagttcacagagcagaaaatgataatgatatctatcttgctttcgag
tttatggatacagatgtacatacggttattcatgcaggcattttgctggatgttcatcaa
agatatatattttggcaacttctttgtgcattaaaattcattcattcagctggtgttata
catcgagatcttaaaccatccaatatgctaataaaatcagattcatcaatcaaagtttgt
gattttggtttgtcaaggtgcataaatgacatgcatcaagacgaattattaacagattac
attgcaactcgctggtatagagcccctgaaattattttcggatcatcaaaatacggacct
ggtattgatatgtgggcggctggctgcatccttgcagaactagtaagtggaagaccacta
ttcccaggagcttccacaatggatcaactagaaagagttatttcattcacaggaatgcca
aacaaagaagacattgaatcaatgcaatgtccgatggttgagacaatgcttggaaactta
acattctccagaccccaattagtattagaagaaagactttctggagccgatccagatgca
atcgatttaattaagaaactttgtcaatttaatccgaacaaaagacctactgctgagcaa
tgtcttgctcatccatacttaaaagccttccatttcgaaagtagagaagtatcttcaagc
gttcaagtcaaaatggccctcagcgatgcaacaaaacatacgataagggaatatagaaat
cagatttataaggaggctgtttcaaatccagacagaggcctaaagaagaagaaatcagat
tcataa

DBGET integrated database retrieval system