KEGG   Trichomonas vaginalis: TVAG_263690Help
Entry
TVAG_263690       CDS       T01022                                 

Definition
(RefSeq) Phosphofructokinase family protein
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
tva  Trichomonas vaginalis
Pathway
tva00010  Glycolysis / Gluconeogenesis
tva00030  Pentose phosphate pathway
tva00051  Fructose and mannose metabolism
tva00052  Galactose metabolism
tva01100  Metabolic pathways
tva01110  Biosynthesis of secondary metabolites
tva01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:tva00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TVAG_263690
   00030 Pentose phosphate pathway
    TVAG_263690
   00051 Fructose and mannose metabolism
    TVAG_263690
   00052 Galactose metabolism
    TVAG_263690
Enzymes [BR:tva01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     TVAG_263690
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     TVAG_263690
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-GeneID: 4763464
NCBI-ProteinID: XP_001317824
UniProt: A2ENZ7
AA seq 434 aa AA seqDB search
MFAQIEEPAKDAPILAIICGGTPVPGLNSVIASSTLSALSNGWRVIAFHDGYVHLSTGDP
EIVKQNMIELNKYMVEHIQRAAGSIIRCDRFDPTRNPQWVSNVQDMLEYFKVRYCLIIGG
TDKVISAHIITQGIDPYSMSVLVIPKTIDNDVCLPYGQSTFGFQSAVQYATQIVKNLVLD
TRSVPRWFIVEVSGRSTGHTALHTAIASGAQLAIIPESFGKRKIELSDVLDLLEGAIYKR
LAVGKNYGVCIVSEGIIENMSGKSQQQLFSNGYIKYDDDGHVNLFEADLSRALTKNLLER
LQARKINVRVNAHKLGPELRGCPPNSFDEVYSKELGFAATEGFRTRHSNAMVVWVNGHIY
FQAFRDIMDQNNRIYPRKVNIDSKEYKVGSFYMWNVKKEDLANPEKVKQLANCANMTPEE
FKKKYTRIVEKIDL
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgtttgcgcagattgaggaaccggcgaaagacgccccaatccttgccatcatttgtggc
ggcactccagtgccaggcctcaactctgtgatagcatctagtactttatccgctctcagc
aatggatggagagtaatcgcgtttcatgatggatacgtacatctttccactggcgatcca
gaaatagtaaaacaaaatatgattgaattaaacaaatatatggtcgaacacattcagcgt
gctgcaggttcaattatcagatgcgatcgatttgatccaacaagaaaccctcaatgggtc
tcaaatgtacaagacatgcttgaatacttcaaagtcagatactgcctgattataggtgga
acagataaagtaatttccgcacatatcattactcaaggcatagatccatattcaatgagt
gtattagtaattccaaagactatcgataacgatgtttgcttaccgtatgggcagtcaact
ttcggatttcagtcggcagttcaatacgcaacacaaattgtcaagaatctcgttctcgat
acgcgctccgtaccgcgctggtttattgtagaggtatccggccgttcaacaggccacaca
gctctccatactgccattgcttctggcgcacaactcgcaattatcccagaatcatttggc
aaaaggaaaatcgaactatccgacgttctcgatctcctcgagggcgctatctacaagagg
cttgctgttggcaaaaactacggtgtttgcattgtttcagaaggaattatcgagaacatg
tccggtaaatcgcaacaacaactattttccaacggatatatcaaatacgatgacgatggc
cacgtaaatctcttcgaagctgacctttctagagcattaacgaaaaatctactcgaaaga
ctacaagcaaggaagattaacgtaagagttaatgctcacaagcttggtcctgagcttaga
ggctgtccaccgaactcatttgacgaggtttactcaaaagaattgggatttgcggcgaca
gaagggttcagaacaagacactccaacgctatggtcgtttgggttaatggacatatatat
ttccaggcgttcagagatattatggaccaaaataacagaatttatccaagaaaagtcaat
atagactccaaggaatacaaggttggctctttctacatgtggaacgtgaagaaggaggat
ttggctaacccagaaaaggtgaaacaactggcaaattgcgctaatatgacacctgaggaa
ttcaagaagaaatacactagaatagttgaaaaaatagacttgtaa

DBGET integrated database retrieval system