KEGG   Trichomonas vaginalis: TVAG_263690Help
Entry
TVAG_263690       CDS       T01022                                 

Definition
Phosphofructokinase family protein
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
tva  Trichomonas vaginalis
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Brite
KEGG Orthology (KO) [BR:tva00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TVAG_263690
   01230 Biosynthesis of amino acids
    TVAG_263690
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TVAG_263690
   00030 Pentose phosphate pathway
    TVAG_263690
   00051 Fructose and mannose metabolism
    TVAG_263690
   00052 Galactose metabolism
    TVAG_263690
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    TVAG_263690
Enzymes [BR:tva01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     TVAG_263690
Protein phosphatases and associated proteins [BR:tva01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     TVAG_263690
Messenger RNA biogenesis [BR:tva03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     TVAG_263690
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 434 aa AA seqDB search
MFAQIEEPAKDAPILAIICGGTPVPGLNSVIASSTLSALSNGWRVIAFHDGYVHLSTGDP
EIVKQNMIELNKYMVEHIQRAAGSIIRCDRFDPTRNPQWVSNVQDMLEYFKVRYCLIIGG
TDKVISAHIITQGIDPYSMSVLVIPKTIDNDVCLPYGQSTFGFQSAVQYATQIVKNLVLD
TRSVPRWFIVEVSGRSTGHTALHTAIASGAQLAIIPESFGKRKIELSDVLDLLEGAIYKR
LAVGKNYGVCIVSEGIIENMSGKSQQQLFSNGYIKYDDDGHVNLFEADLSRALTKNLLER
LQARKINVRVNAHKLGPELRGCPPNSFDEVYSKELGFAATEGFRTRHSNAMVVWVNGHIY
FQAFRDIMDQNNRIYPRKVNIDSKEYKVGSFYMWNVKKEDLANPEKVKQLANCANMTPEE
FKKKYTRIVEKIDL
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgtttgcgcagattgaggaaccggcgaaagacgccccaatccttgccatcatttgtggc
ggcactccagtgccaggcctcaactctgtgatagcatctagtactttatccgctctcagc
aatggatggagagtaatcgcgtttcatgatggatacgtacatctttccactggcgatcca
gaaatagtaaaacaaaatatgattgaattaaacaaatatatggtcgaacacattcagcgt
gctgcaggttcaattatcagatgcgatcgatttgatccaacaagaaaccctcaatgggtc
tcaaatgtacaagacatgcttgaatacttcaaagtcagatactgcctgattataggtgga
acagataaagtaatttccgcacatatcattactcaaggcatagatccatattcaatgagt
gtattagtaattccaaagactatcgataacgatgtttgcttaccgtatgggcagtcaact
ttcggatttcagtcggcagttcaatacgcaacacaaattgtcaagaatctcgttctcgat
acgcgctccgtaccgcgctggtttattgtagaggtatccggccgttcaacaggccacaca
gctctccatactgccattgcttctggcgcacaactcgcaattatcccagaatcatttggc
aaaaggaaaatcgaactatccgacgttctcgatctcctcgagggcgctatctacaagagg
cttgctgttggcaaaaactacggtgtttgcattgtttcagaaggaattatcgagaacatg
tccggtaaatcgcaacaacaactattttccaacggatatatcaaatacgatgacgatggc
cacgtaaatctcttcgaagctgacctttctagagcattaacgaaaaatctactcgaaaga
ctacaagcaaggaagattaacgtaagagttaatgctcacaagcttggtcctgagcttaga
ggctgtccaccgaactcatttgacgaggtttactcaaaagaattgggatttgcggcgaca
gaagggttcagaacaagacactccaacgctatggtcgtttgggttaatggacatatatat
ttccaggcgttcagagatattatggaccaaaataacagaatttatccaagaaaagtcaat
atagactccaaggaatacaaggttggctctttctacatgtggaacgtgaagaaggaggat
ttggctaacccagaaaaggtgaaacaactggcaaattgcgctaatatgacacctgaggaa
ttcaagaagaaatacactagaatagttgaaaaaatagacttgtaa

DBGET integrated database retrieval system