KEGG   Trichomonas vaginalis: TVAG_267290Help
Entry
TVAG_267290       CDS       T01022                                 

Definition
CAMK family protein kinase
Orthology
K08866  
serine/threonine-protein kinase TTK/MPS1 [EC:2.7.12.1]
Organism
tva  Trichomonas vaginalis
Brite
Enzymes [BR:tva01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     TVAG_267290
Protein kinases [BR:tva01001]
 Serine/threonine protein kinases: Other group
  TTK family
   TVAG_267290
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 537 aa AA seqDB search
MLPKTRKPLASLPASQMNVPRDLNSKMKLSSKIDKTTSSSSSASSNEGNEINEKVKKPKL
NFLQVTHHRAVVKVNGNVYYHIDKEPIGAGGTSKVYKVANAHGEEFALKVVDYSNAEDKT
IVETYRKEIEILEQFKGEDKIIQLIDSEINESKQKIYLVQELGDEDLKKFMESCPNDKFD
IQLIQKIWFEILSSVKVVHDKSYCHTDLKPENFLFVNGRLKLIDFGIAEKVNIHEDTTRV
TRTNAVGTLNYMAPETLDPQNRKVGRTTDVWALGCILYRLVYHKMPFPQSKPELKILAIT
GGMPYEVVYDSIGYDEDPPELPLIQHIIQQCLQRDPKLRPEIHELLNEPLIPLPESAEPT
KEQNESEMEMIPGEPEDITPEEKLNDVDSVISHDESDSHHEIIESAHEIIDYNDPEFVNY
RRFPGYFIFQFLLEFINFIQENVSSQPTMENVFSSLHISKLIEDYHIEEISSKFSIADFK
SRLLHLADQIFNDYSDDDFNSQNTGHTIVSYLTKMFCKNQEFDVNSALRKWSYYHQN
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
atgcttcctaaaacgcgtaagccactcgcatctttgcctgcaagtcaaatgaatgtccca
agagatctaaacagtaaaatgaagctttcttcgaaaatagataaaactacatcttcatca
tcatctgcaagtagcaacgaaggaaatgaaatcaatgaaaaagttaaaaagccaaagctt
aatttcctacaagtaacccatcacagagctgtagttaaagtaaacggaaatgtttattat
catatcgataaagagccaataggtgcaggcggtacatctaaagtttataaggttgccaat
gcgcacggcgaagaatttgcattaaaagtcgtagactactcaaatgccgaagataagaca
attgtcgaaacctatagaaaagaaattgagattttagaacaatttaagggcgaagataag
atcatacagctcattgatagtgaaatcaatgaatcgaagcaaaagatttatcttgttcaa
gagcttggtgatgaagaccttaagaagttcatggaatcatgtccaaatgataagtttgac
atacaattaatccaaaagatatggtttgaaatactttcttctgttaaagttgttcatgat
aagtcatattgccatacagatctaaaaccagagaatttcttgtttgtaaatggacgcctt
aagcttatcgattttgggattgcagaaaaagttaatatacacgaagatacaactcgcgta
acaagaacaaacgcagttggaactctaaactatatggcacctgaaactttggatcctcag
aaccgtaaagttggaagaacaacagatgtatgggctttagggtgtattttgtatcgttta
gtttatcacaaaatgccatttcctcaatcaaagccagagttgaaaattttggcaatcaca
ggtggaatgccatacgaagtcgtctacgattcaataggatatgatgaagatccaccagaa
ttacctttaattcaacatatcattcagcaatgcttgcaaagagatccaaaattgaggcca
gagatacacgaacttcttaatgagcctttgattccacttccagaatcagcagaaccaacc
aaagaacaaaatgaatcagaaatggaaatgattccaggagaaccagaagacataacacct
gaagaaaagctaaatgatgtcgattctgttatttctcatgacgaaagtgattctcatcat
gagattatcgaatctgctcatgaaataatcgattacaatgacccagagttcgttaattat
agaaggttccctggctactttatattccaattcttgcttgaattcattaattttatccag
gaaaatgtttcatctcaaccaacaatggaaaatgttttcagttcattgcacatatctaag
ctgattgaagactatcatattgaagaaatctcttcaaagttctcaattgcagattttaag
tcgagattactgcacttggctgatcaaatcttcaatgattattcagatgatgacttcaac
tctcaaaatacaggtcatactattgtttcttatctcacaaaaatgttttgtaagaatcaa
gaatttgatgttaactctgcattaaggaaatggtcatattatcatcaaaattaa

DBGET integrated database retrieval system