KEGG   Trichomonas vaginalis: TVAG_271550Help
Entry
TVAG_271550       CDS       T01022                                 

Definition
hypothetical protein
Orthology
K14527  
ribonuclease P/MRP protein subunit RPP20 [EC:3.1.26.5]
Organism
tva  Trichomonas vaginalis
Pathway
Ribosome biogenesis in eukaryotes
RNA transport
Brite
KEGG Orthology (KO) [BR:tva00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    TVAG_271550
   03008 Ribosome biogenesis in eukaryotes
    TVAG_271550
Enzymes [BR:tva01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.5  ribonuclease P
     TVAG_271550
Ribosome biogenesis [BR:tva03009]
 Eukaryotic Type
  Pre-60S particles
   RNases
    RNase MRP
     TVAG_271550
Transfer RNA biogenesis [BR:tva03016]
 Eukaryotic Type
  5'processing factors
   Ribonucrease P
    TVAG_271550
Mitochondrial biogenesis [BR:tva03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   RNase MRP
    TVAG_271550
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 114 aa AA seqDB search
MDSRPVVKLTLEHPKKTETDIYITKSMALMPMVEEIIKKLHNHNEITLHATGAANYKALK
IATVVKSMQKGLVEATVTTHTVSTTDFLIPTKIGEKKEQKSRNMNAVTIVLSIK
NT seq 345 nt NT seq  +upstreamnt  +downstreamnt
atggattctcgacctgttgtcaaacttacccttgagcatccaaagaaaacagaaacggac
atatatattacaaaaagtatggcactaatgccaatggtagaagaaataatcaagaaactt
cacaatcataatgaaattacactccacgcaacaggcgctgcaaattataaagcgctaaag
atagcaacagtagtaaaatctatgcagaagggcttggttgaagcaacagttacaactcat
acagtatcaacaactgactttctcattcctacaaaaataggtgaaaagaaagaacagaag
tcgcgtaatatgaacgctgttacaattgttctttcaattaaatag

DBGET integrated database retrieval system