KEGG   Trichomonas vaginalis: TVAG_271550Help
Entry
TVAG_271550       CDS       T01022                                 

Definition
hypothetical protein
Orthology
K14527  
ribonuclease P/MRP protein subunit RPP20 [EC:3.1.26.5]
Organism
tva  Trichomonas vaginalis
Pathway
Ribosome biogenesis in eukaryotes
RNA transport
Class
Genetic Information Processing; Translation; RNA transport [PATH:tva03013]
Genetic Information Processing; Translation; Ribosome biogenesis in eukaryotes [PATH:tva03008]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 114 aa AA seqDB search
MDSRPVVKLTLEHPKKTETDIYITKSMALMPMVEEIIKKLHNHNEITLHATGAANYKALK
IATVVKSMQKGLVEATVTTHTVSTTDFLIPTKIGEKKEQKSRNMNAVTIVLSIK
NT seq 345 nt NT seq  +upstreamnt  +downstreamnt
atggattctcgacctgttgtcaaacttacccttgagcatccaaagaaaacagaaacggac
atatatattacaaaaagtatggcactaatgccaatggtagaagaaataatcaagaaactt
cacaatcataatgaaattacactccacgcaacaggcgctgcaaattataaagcgctaaag
atagcaacagtagtaaaatctatgcagaagggcttggttgaagcaacagttacaactcat
acagtatcaacaactgactttctcattcctacaaaaataggtgaaaagaaagaacagaag
tcgcgtaatatgaacgctgttacaattgttctttcaattaaatag

DBGET integrated database retrieval system