KEGG   Trichomonas vaginalis: TVAG_275770Help
Entry
TVAG_275770       CDS       T01022                                 

Definition
Inositol monophosphatase family protein
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
tva  Trichomonas vaginalis
Pathway
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tva00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    TVAG_275770
Enzymes [BR:tva01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     TVAG_275770
Transfer RNA biogenesis [BR:tva03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    TVAG_275770
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 325 aa AA seqDB search
MNFGTWAPEINAAINILKPAIDISLVGQEKLRKADIETKNDGTVVSIVDFACQSVIMDGL
KKNFPKDSVLGEEDVRKIDDKFLNHVKSLLPDDIDPVSTCSSAITKISDKDERTWVIDPI
DGTYGFVNGGNFAIAMALLVNRHVVCSAVAWPRHDVNSTGLIDFEGPAIFVSSEGYGAYA
MDLKGHWKKLTKPDNPAFRIIHTKQKQGNVVQLFDYVKQHLGITDEIEMVSMTKGFVLAT
GNACAFFRVPWDSNEEHVWDIAPFELLVREAGGFATTGTGKEILYRQNARVEGSLDGLVF
TNRDKEFHNKVVEILQEALAMFKWY
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgaattttgggacttgggctccagaaatcaatgcagcaattaatattctaaaaccagca
atagatatctcgcttgttggccaagaaaaattaagaaaagctgatattgaaaccaaaaat
gacggaacagttgtttccattgtagattttgcatgtcaatcagtgataatggatggactt
aaaaagaattttccgaaagattcagtactcggcgaagaagatgttagaaaaattgatgat
aagttcttaaatcatgtcaaatccttattaccagatgacattgatccagtatctacttgt
tcatcagccattacaaagatatccgataaagatgaaagaacctgggttattgatccaatt
gatggaacctatggctttgttaatggtggaaactttgctattgctatggctttacttgtt
aatcgccatgttgtttgctccgcagttgcttggccacgtcatgatgtaaattcaaccgga
ctcatcgattttgaaggcccagccatattcgtatcttcagaaggttatggtgcatacgct
atggacttgaaaggacattggaagaagcttaccaaaccagataatcccgcatttcgaatt
attcatacgaaacagaaacaaggaaacgttgtacaactatttgattacgttaagcagcac
ctaggaattacggatgagattgaaatggtctctatgactaaaggatttgtgttggcaact
ggaaatgcgtgcgcattcttcagagttccatgggattcaaacgaagagcacgtttgggac
attgctccgtttgaattgcttgttcgcgaggctggaggattcgcgacaacaggaacagga
aaagaaattttgtacagacaaaatgcacgtgttgaaggttctttggacggccttgtattc
acgaacagagacaaggaattccataacaaggtagtggaaatactacaggaagctcttgca
atgttcaaatggtattaa

DBGET integrated database retrieval system