KEGG   Trichomonas vaginalis: TVAG_276310Help
Entry
TVAG_276310       CDS       T01022                                 

Definition
1,4-alpha-glucan branching enzyme IIB, chloroplast precursor
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
tva  Trichomonas vaginalis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tva00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    TVAG_276310
Enzymes [BR:tva01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     TVAG_276310
Exosome [BR:tva04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   TVAG_276310
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 671 aa AA seqDB search
MQIIKDNPWLEQWRGGLEWRQHLYQEAKKRIEDIAGSLDKFTQAYKEFGVHKVEGGILYR
EWAPNADEIYLAGDFNNWNCEDPATKCEKEDEYGHFKLFLKDTKEGPVIPHNSKIKCCLK
LKSGETVWRIPAWINYVRQNTENIDFNGIFWNPEKKYVFKHPKPAPLDCALLIYETHIGM
AGVEPRIHTYKEFEENVLPMIKKDGYNAIQIMAVMEHPYYGSFGYQVTNFFAISSRFGTP
EELKSMIDTAHGMGIHVFLDLVHSHASKNVAEGINHFDGTDHQYFHEGGRGYHPLWDSRC
FNYNHPEVQRFLLSNLRYYMEEYSFDGFRFDGVTSMMYLHHGNMYSFNSIDCYFCDLVDR
EAVTYLMLANTVIHMVNPNAISIAEDVSGMVGLARSIEDGGMGFDYRLGMSSPDMWIKML
KEQRDEDWNVGNVAFELSNRPYKEKTVAYSESHDQALVGDKTIAFWLMDKEMYTNMSCLQ
PESMITARGMALHKIIRLITIGLGGEAYLNFMGNEFGHPEWIDFPREGNGNSFLHCCRRF
DLPFTDHLRYKYLLAFDNAMIKLEHDYKFMESGHMYITLKHEEDKVIAFERGELFFVFNM
HTHKSFTDYAIGIEWPGKYKCILSSDDEEFGGHSTIDKSVIHETFPEPWQCRQNKIILYI
PCRTAAVYKRV
NT seq 2016 nt NT seq  +upstreamnt  +downstreamnt
atgcaaatcatcaaagacaacccatggctcgaacaatggcgcggcggtctcgaatggcgc
cagcacttataccaagaagctaagaagcgaatcgaagatatcgctggctccttggataaa
ttcacacaagcatacaaagagtttggtgtccacaaagtagaaggcggtatcctttaccgt
gaatgggcaccaaatgccgatgagatatatcttgccggtgacttcaacaactggaattgt
gaagatccagcaacaaagtgcgaaaaggaagacgaatacggccacttcaaactcttcctc
aaggatacaaaggagggcccagttatcccacacaacagcaagattaaatgctgcctcaag
ctcaagagcggcgaaacagtttggagaattccagcctggatcaactacgttcgccaaaac
acagagaacatcgatttcaatggtatcttctggaatccagagaagaagtatgttttcaag
catccaaagccagctccactcgactgtgcacttctcatttatgagacacacatcggtatg
gctggtgttgaaccacgtatccacacatacaaggagttcgaagagaatgttctcccaatg
atcaagaaggacggttacaacgccatccagatcatggctgtcatggagcacccatactac
ggttccttcggctaccaggttacaaacttcttcgccatctcatcacgtttcggcacacca
gaagagcttaagtccatgattgatacagcacacggaatgggcatccatgtcttcctcgat
cttgtccactcccacgcctcaaagaacgttgctgaaggtatcaaccacttcgatggcaca
gatcaccagtacttccacgaaggtggccgtggctatcacccattgtgggattcccgctgc
ttcaactacaaccacccagaagtccagcgcttccttctctccaacctcagatactacatg
gaagagtacagcttcgatggcttccgcttcgatggtgtcacatccatgatgtacctccac
cacggaaacatgtactcattcaacagcatcgactgctacttctgcgacctcgtcgatcgt
gaggctgttacatacctcatgctcgcaaacacagtcatccacatggtcaatccaaacgct
atctccattgctgaagatgtctccggcatggttggcctcgctcgttcaatcgaagatggt
ggtatgggtttcgactaccgcctcggcatgagcagcccagatatgtggatcaagatgctc
aaggagcagcgcgatgaagactggaacgtcggcaatgtcgccttcgagttatccaacaga
ccatacaaggagaagacagttgcttactccgaatcccacgaccaggcacttgtcggtgat
aagacaatcgccttctggctcatggacaaggaaatgtacacaaacatgtcctgcctccag
ccagagtcaatgatcacagctcgtggtatggctctccacaagatcatccgcctcatcaca
atcggtcttggtggtgaagcttacctcaacttcatgggtaacgagttcggccatccagag
tggatcgacttcccacgtgagggcaacggcaactcattcctccactgctgccgcagattc
gacttaccattcacagaccacctcagatacaagtacctcctcgctttcgataacgccatg
atcaagctcgaacacgactacaagttcatggagtccggccacatgtacatcacattgaag
cacgaggaagacaaggtcatcgctttcgaacgcggtgagctcttcttcgtcttcaacatg
cacacacacaagtcattcactgactacgctatcggtatcgaatggccaggcaagtacaag
tgcatcctctcatctgatgatgaagaattcggtggacacagcacaatcgataagtcagtc
atccacgagacattcccagaaccatggcaatgcagacagaacaagatcatcctctacatc
ccatgcagaactgccgcagtttacaagcgtgtttaa

DBGET integrated database retrieval system