KEGG   Trichomonas vaginalis: TVAG_284350Help
Entry
TVAG_284350       CDS       T01022                                 

Definition
Phosphatidylinositol 3- and 4-kinase family protein
Orthology
K00922  
phosphatidylinositol-4,5-bisphosphate 3-kinase [EC:2.7.1.153]
Organism
tva  Trichomonas vaginalis
Pathway
Inositol phosphate metabolism
Phosphatidylinositol signaling system
Class
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:tva00562]
Environmental Information Processing; Signal transduction; Phosphatidylinositol signaling system [PATH:tva04070]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1040 aa AA seqDB search
MPLFVFNAEEFVEHNSILAENIPLPNFTRKHPKITLVVQLPTNLVIECEAKLSKTISSIQ
KSIYEQMVSLYGETNVRSIKQYRFGTMKGEYPSKKLKLSESPEIMNALKLQQQDYSNPQF
IIIQVNTETEFVKTAKTYTNDLELKPIIATPEVLSFNSTYSELRQNAETARTERLEADPL
LARMRLNSNEPPLITCRKKNIPIKVDMRAVALSDENTATSLAIQFDTTAQQAIRTLFTKM
VEHQGVSTDLNPDNYALILQGTDEVVAGDFAIQNFVCVRQFLLSVTPFMNFLLVDKNKLI
SQIREKELSYTALPEVTDEQKYKPIIYNDTSKPGIDIMGGFPHFYAKENFSIIIGGCFNI
PSDLEANNYIVRVVILHGSNEISAPMMTRPSLGCSSVAWNEALNISIQIMQLPRAARVAI
TLFNYDKIGTNKAPIATCNVPVFNFDGWFNSGVKFWSMWNGKDTDPLLTTCQCEEESAVR
VLFTIPQYRYPIAHVQQEIMHQRVVSTSQRVSSQTKIIVEEMRKKNFDLLKKPTDEARAN
LYRYRYDFIDIPSMLPLVLSSIDYTVTTQVNEIPALLQRWQRPPPTIALSLLDSQYADHR
VREFAVRCLESLSDDEIMLYMLQLIQALKYEMYDDSPLCRFLFRRGLNEPKFLGHQLFWQ
LISEAHISHIRRRFSSFVVNFLYGSGIYRDELLKGYKFTQELVRLNHSLCKLSHAEATEP
FREALKKIDLPNEFHLPMDPRLVVDSFIVEKCKVMNSKKKPFWLTFHNAAPFSTEPIRVL
FKVGDDLRQDQLTLQIMRVMEHLWRKEGIDLHMRCYAVLPTGFNQGFIEVVPNTITEQAL
QQERGTFSGIWDSSTISDYLCKVNQTEQNQQVARSNFMYSSAGYAVATCVLGIADRHPGN
ILLQNDGHFLHIDFGHFLGNFKTKLGYQRENAPFHFSPACANVLGDVDGEMFKQFRVLCG
QAFNILRHNSKLLVTLLMLMLGTGIPELQKAEDIRYMTDMLMLNKTDSEAKIEFDKLTNK
SLESTRTKLNNLFHNIAVSD
NT seq 3123 nt NT seq  +upstreamnt  +downstreamnt
atgccattatttgtttttaatgctgaagagttcgttgaacacaattctattttagcggag
aacataccattgcccaattttactcgaaagcatcctaaaattactcttgttgttcaatta
ccgacaaatttagtgattgaatgtgaagccaaattatcgaaaacgatcagttcaatccaa
aaatctatatatgagcaaatggtttcgctttacggagagacaaatgttcgttcaattaag
caatacagatttggtactatgaaaggcgaatacccgtcgaagaaattgaaattatccgag
tcaccggagataatgaacgctctgaaacttcagcaacaggattattcgaatccgcaattc
attattattcaagtaaatacagaaacagagtttgtaaagaccgctaagacatatacgaat
gacctagaactcaaaccgattatcgctacccctgaagttttgtcatttaattcgacttac
tcggaattgaggcaaaatgccgagacagctaggacagaaaggcttgaagcagatccgtta
ctcgcaagaatgcgtctaaattcgaacgaacctcctttaataacttgcagaaagaaaaat
atcccaatcaaagtcgacatgcgcgcagtagcattatcagatgaaaacacagcgacatct
ctcgcgattcaattcgatactacagcacaacaagccattcgaactttatttacaaaaatg
gtcgagcaccaaggtgtttctaccgacctaaatcccgataattacgcacttattttacaa
ggcacagacgaagtcgttgccggtgactttgcgatccaaaatttcgtatgtgtcaggcaa
tttcttctttctgtgactccgttcatgaatttccttcttgtcgacaagaacaaactcatt
tcccagatcagagagaaagaattaagctacacagcccttcctgaagtaactgatgaacag
aaatacaaaccgatcatttacaacgacacttccaagcccggtattgacatcatgggtgga
tttccacatttctacgccaaagagaacttctcaattatcattggcggatgtttcaatatt
ccaagcgatctcgaagcgaacaactacattgtcagagttgttattttgcatggcagtaat
gagatctccgctccaatgatgactagaccttctttaggctgttcttccgttgcatggaat
gaagcattaaacatttccatccaaatcatgcaactaccacgtgcagcacgtgtagccatc
actctcttcaactacgacaagatcggtacaaacaaagctccaatagctacatgcaatgtc
cctgttttcaatttcgacggatggttcaattccggagttaaattctggtcgatgtggaat
ggaaaagacactgatcctttgttgacaacatgtcaatgcgaagaagaatctgctgtcaga
gttcttttcaccattcctcaatacagatatccaattgcacatgtacaacaagagatcatg
catcaaagagttgtttctacttcgcaaagagtttcttcacaaacgaaaatcatcgttgaa
gagatgcgtaaaaagaatttcgatttactgaagaaaccaacagatgaagccagagcaaac
ttatatagatatcgatatgatttcattgatattcctagtatgttacctttagttctttct
tcaattgattacacagtaacaacacaagtgaatgaaatccctgctttgttacaaagatgg
caaagacctcctcctacaattgctttgagtctcttggattcacagtacgctgatcataga
gttagagaattcgctgttcgttgtttggaatcattaagtgatgatgaaatcatgttgtat
atgttacaattgatacaagctttgaaatacgaaatgtatgatgattctccactttgtaga
ttcttgtttagaagaggtttgaatgagccaaagttcttgggacatcaattgttctggcag
ttgatttctgaagctcatatctctcatattcgcagaagattctccagtttcgtcgtcaat
ttcttatacggatcaggaatttacagagatgaactgttgaaaggttacaaattcactcaa
gaattagtgagattgaaccattctttgtgcaaattatctcacgcagaagcaacagaacct
ttcagagaagcactcaagaaaattgaccttccaaacgagttccatctgcctatggatcca
agattggtcgttgattcattcatcgttgaaaaatgtaaagttatgaattcaaagaaaaaa
ccgttttggcttacatttcataatgcagcaccattttcaacggaaccaattcgtgttttg
ttcaaagtcggtgatgacttgagacaagaccaattaactctacaaatcatgagagttatg
gaacatttatggagaaaggaaggaattgatttacacatgagatgttatgcggttttgcca
acaggtttcaatcaaggattcatcgaagttgttccaaatactatcactgaacaagcacta
caacaagagagaggaacattcagtggtatttgggattcttcaacaatttctgattatctt
tgcaaagtaaaccaaacggaacaaaaccaacaagtcgcaagaagcaatttcatgtattct
tctgccggttacgctgttgcaacatgcgttttaggtatcgctgatagacatccaggaaat
attttgttacaaaatgatggccactttttacatattgattttggtcactttttgggcaat
ttcaagacaaaattaggataccaacgagaaaatgcaccattccatttctctcctgcatgt
gcaaatgttcttggtgatgttgatggagagatgttcaagcaatttagagttctttgcggt
caggctttcaacattttgaggcataactctaaattacttgttactttgctgatgttgatg
ttgggaacaggaatccctgaattacaaaaggcagaagatatcagatacatgactgacatg
ttgatgctcaacaaaactgattcggaagcaaagattgagttcgacaaactcacaaataag
tctctcgaatcaacaaggactaagcttaataacttattccataatattgctgtttcagat
taa

DBGET integrated database retrieval system