KEGG   Trichomonas vaginalis: TVAG_293770Help
Entry
TVAG_293770       CDS       T01022                                 

Definition
Phosphofructokinase family protein
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
tva  Trichomonas vaginalis
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Brite
KEGG Orthology (KO) [BR:tva00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TVAG_293770
   01230 Biosynthesis of amino acids
    TVAG_293770
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TVAG_293770
   00030 Pentose phosphate pathway
    TVAG_293770
   00051 Fructose and mannose metabolism
    TVAG_293770
   00052 Galactose metabolism
    TVAG_293770
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    TVAG_293770
Enzymes [BR:tva01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     TVAG_293770
Protein phosphatases and associated proteins [BR:tva01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     TVAG_293770
Messenger RNA biogenesis [BR:tva03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     TVAG_293770
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 326 aa AA seqDB search
MSLKNIAVLTSGGDNAGLNAAVRAITRVGIARNVNVYGVLRGYRGLVEGQIFELNSRAVS
GKMGLGGTFIGTARLPEWKDPKVRREAIRNMNRHDIGGLIVIGGNGSLSGASLLAKDGFP
VIGMPGSIDDDVMGTEVCVGVDTALNIIIEAIDRIRDCASSIQRAFVIEVMGRDSGALAL
MSAAATGAEVCLVPEIPSPPMEKIADAITNAYTKGKPYAIIVVAEGWKPGINKLVEFLNS
KQDETGFDVRTTVLGYTQRGGSPSYIDRYYGTAMGAFAVDSLLAGETNKFVAVQNGKPCL
QPLDTLVGKLKPLNKNLLDLYNKLDN
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcttaaaaatatcgcagtcttaacatccggcggtgataacgcaggccttaatgca
gctgttcgtgcgatcacacgtgttggaattgcaagaaacgtaaatgtttatggcgtttta
agaggatatcgtggacttgtcgaaggacaaattttcgaattaaattcgcgcgcagtttct
ggtaagatgggacttggtggcacattcattggtacagctcgtcttccagaatggaaagat
ccaaaagttcgccgtgaagctattcgtaacatgaaccgtcacgatattggcggtctcatc
gtcatcggtggtaatggctccctctctggtgcttccttgttagcaaaggatggttttcca
gtcattggtatgccaggctcaattgatgacgatgttatgggcacagaagtctgcgttggt
gtcgatacagctctcaacattattattgaggctattgatcgcattagagattgcgcttct
tcaattcaacgtgcattcgttattgaagttatgggtcgtgattcaggcgctcttgcttta
atgtcagctgctgctacgggcgctgaagtttgccttgttccagaaatcccatcaccacca
atggagaaaattgcagatgcaatcacaaacgcttacacaaagggcaaaccatacgctatc
attgttgtcgctgaaggctggaagccaggtatcaacaaacttgtcgaattcttgaattca
aagcaagatgaaacaggtttcgatgttcgtacaacagttctcggctacacacagcgtggt
ggatcaccatcttacatcgacagatattacggcactgctatgggcgctttcgctgttgat
tcccttcttgctggcgaaacaaacaaattcgtcgctgttcagaacggaaaaccctgcctt
caaccactcgatactcttgttggcaaacttaagccactcaacaagaatcttctcgactta
tacaacaaacttgataactaa

DBGET integrated database retrieval system