KEGG   Trichomonas vaginalis: TVAG_293770Help
Entry
TVAG_293770       CDS       T01022                                 

Definition
Phosphofructokinase family protein
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
tva  Trichomonas vaginalis
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Class
Metabolism; Overview; Carbon metabolism [PATH:tva01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:tva01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:tva00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:tva00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:tva00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:tva00052]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 326 aa AA seqDB search
MSLKNIAVLTSGGDNAGLNAAVRAITRVGIARNVNVYGVLRGYRGLVEGQIFELNSRAVS
GKMGLGGTFIGTARLPEWKDPKVRREAIRNMNRHDIGGLIVIGGNGSLSGASLLAKDGFP
VIGMPGSIDDDVMGTEVCVGVDTALNIIIEAIDRIRDCASSIQRAFVIEVMGRDSGALAL
MSAAATGAEVCLVPEIPSPPMEKIADAITNAYTKGKPYAIIVVAEGWKPGINKLVEFLNS
KQDETGFDVRTTVLGYTQRGGSPSYIDRYYGTAMGAFAVDSLLAGETNKFVAVQNGKPCL
QPLDTLVGKLKPLNKNLLDLYNKLDN
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcttaaaaatatcgcagtcttaacatccggcggtgataacgcaggccttaatgca
gctgttcgtgcgatcacacgtgttggaattgcaagaaacgtaaatgtttatggcgtttta
agaggatatcgtggacttgtcgaaggacaaattttcgaattaaattcgcgcgcagtttct
ggtaagatgggacttggtggcacattcattggtacagctcgtcttccagaatggaaagat
ccaaaagttcgccgtgaagctattcgtaacatgaaccgtcacgatattggcggtctcatc
gtcatcggtggtaatggctccctctctggtgcttccttgttagcaaaggatggttttcca
gtcattggtatgccaggctcaattgatgacgatgttatgggcacagaagtctgcgttggt
gtcgatacagctctcaacattattattgaggctattgatcgcattagagattgcgcttct
tcaattcaacgtgcattcgttattgaagttatgggtcgtgattcaggcgctcttgcttta
atgtcagctgctgctacgggcgctgaagtttgccttgttccagaaatcccatcaccacca
atggagaaaattgcagatgcaatcacaaacgcttacacaaagggcaaaccatacgctatc
attgttgtcgctgaaggctggaagccaggtatcaacaaacttgtcgaattcttgaattca
aagcaagatgaaacaggtttcgatgttcgtacaacagttctcggctacacacagcgtggt
ggatcaccatcttacatcgacagatattacggcactgctatgggcgctttcgctgttgat
tcccttcttgctggcgaaacaaacaaattcgtcgctgttcagaacggaaaaccctgcctt
caaccactcgatactcttgttggcaaacttaagccactcaacaagaatcttctcgactta
tacaacaaacttgataactaa

DBGET integrated database retrieval system