KEGG   Trichomonas vaginalis: TVAG_296750Help
Entry
TVAG_296750       CDS       T01022                                 

Definition
MOZ/SAS family protein
Orthology
K11308  
histone acetyltransferase MYST1 [EC:2.3.1.48]
Organism
tva  Trichomonas vaginalis
Brite
Enzymes [BR:tva01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     TVAG_296750
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 380 aa AA seqDB search
MESKRLSVGDVVSVYCEQYMQKMDAVILTFNIQKQVAYVHFIKQDKRLDRWVPISEISDD
PNVICFMTEDKLSSRTVRKLLDEEDVDKLEPQYQQFEEAHQETTRIRNIDRITIGPYTVK
AWYYSPYPNPFGKMEHIYICDHCFQYFESAQKLKEHLMKTGEKCPPGQEIYRHDNLSIFE
MKGWIDKVPCQCLCLLSKLFLDHKTLFYDVEGFLFYVICECDNNGAHIAAYFSKEVNCLA
GNVLSCITTLPPYQKKGYGNLCISLSYELARRSRRAGGPEKPLSDLGKLAFSSYWKDTLL
ELFNTRESEMTSLDNIVILTSIQKEDIIYSLKQFHCFTKVKGEYEIDVSSPSLRQAIEKH
RSATPKRKIDPQYLTWLPES
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atggaatcgaaaagattaagtgttggtgatgttgtgagtgtttattgcgaacaatatatg
caaaaaatggatgcagtcatcctaacatttaatatacaaaagcaggtagcttacgttcat
tttataaaacaagataaaagattagatagatgggttcctatttcagagatatctgacgat
cccaatgtaatatgcttcatgactgaagataaactatcatcaagaacagttagaaaactc
cttgacgaagaagatgtagataaacttgaaccacaatatcaacaattcgaagaagcacac
caagagacgacaagaatcagaaatattgatcgaattactatcggtccttatacagttaaa
gcttggtattattctccgtatccaaatccatttggaaagatggaacacatatatatttgt
gatcattgctttcaatactttgaatctgcacaaaaattaaaagaacatcttatgaaaaca
ggcgaaaaatgccctccaggccaagaaatatacagacatgacaatttaagcatcttcgag
atgaagggatggatagataaagtgccatgccaatgtctttgtctactttcgaagcttttt
ttagatcacaaaactttattttacgatgttgaaggatttctattctatgttatatgcgaa
tgcgacaacaatggtgctcatattgcagcatacttctcaaaagaagtaaattgcttagca
ggaaatgtattatcctgtattactactttaccaccttatcaaaagaaaggatacggtaac
ttatgcatatctctcagctatgaacttgccagacgctccagaagagccggtggcccagaa
aaaccattatctgatttaggaaaattggccttctcttcatattggaaggacacattactt
gaattatttaatacaagagaatcagaaatgacatcacttgataatatcgtaattttgaca
agtatacaaaaagaagatataatttattcccttaaacagttccattgctttacaaaagtc
aaaggagaatatgagattgatgtatcttcaccaagccttcgacaagcaattgaaaaacat
cgaagtgcaactccaaaaagaaaaattgatccacaataccttacatggcttccagaatca
tga

DBGET integrated database retrieval system