KEGG   Trichomonas vaginalis: TVAG_300450Help
Entry
TVAG_300450       CDS       T01022                                 

Definition
AGC family protein kinase
Orthology
K08850  
aurora kinase, other [EC:2.7.11.1]
Organism
tva  Trichomonas vaginalis
Brite
Enzymes [BR:tva01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     TVAG_300450
Protein kinases [BR:tva01001]
 Serine/threonine protein kinases: Other group
  Aur family [OT]
   TVAG_300450
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 297 aa AA seqDB search
MSIAKENISPSNTPIAKSPRRNGQASRSQVKKWSLDDFEIGRPLGTGKFGRVYLAREAKS
KFIVGIKVLNKAQLQKASIEHQLRREIEIQSHLRHPNIIRLYGYFYDATRIYLIIEYAAR
GELFSILRDAGRFDEHTAAEYIVQMCDAIDYCHSKHIIHRDIKPENILVGLNGELKIADF
GWSVHAPTSRRTTLCGTLDYLPPEMIEGYDHDNSVDIWSLGVLLYEFLVGEPPFETDSQR
NTCRRIINVDIRFPSFVTPLARDLILRFLQKDPAKRMPLSQVRSHPWIVQQLGPAPK
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgagtattgccaaggaaaatatctccccgtccaacactccaattgctaaatcaccacgc
aggaatggtcaggctagtcgttcacaagtaaagaagtggtcccttgacgattttgagatt
ggtcgcccacttggtacaggtaaatttggacgagtttacctcgctcgtgaagctaaatct
aagttcattgttggcatcaaagttcttaacaaagctcagcttcaaaaggcttctattgag
catcagctccgtcgcgaaatcgaaatccagtctcatcttcgtcatccaaatatcatccgc
ctatatggatacttttatgatgctacaagaatctatcttattattgaatacgctgctcgc
ggtgagttattttctattctccgcgatgcaggcagatttgacgagcatacagcagctgaa
tacattgttcagatgtgtgatgctattgattactgccattcaaagcacattatccaccgt
gatatcaaaccagaaaatattcttgtcggattgaacggagaactcaaaatcgcagatttc
ggctggtcagttcatgctccaacatcccgtcgtacaactctttgcggtacacttgactac
cttccaccagaaatgattgaaggttatgatcatgataactctgttgatatttggagcctt
ggtgtcctcttatacgaattcttggtaggtgagccaccgtttgagacagactctcaacgc
aacacatgccgtcgtatcattaatgttgatatccgcttcccatcatttgttacccctctt
gctcgcgatttgatcttacgtttcctccagaaggatccagctaagagaatgccactttct
caggtccgttcccatccatggattgttcaacagcttggcccggcaccaaagtaa

DBGET integrated database retrieval system