KEGG   Trichomonas vaginalis: TVAG_300450Help
Entry
TVAG_300450       CDS       T01022                                 

Definition
AGC family protein kinase
Orthology
K08850  
aurora kinase, other [EC:2.7.11.1]
Organism
tva  Trichomonas vaginalis
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 297 aa AA seqDB search
MSIAKENISPSNTPIAKSPRRNGQASRSQVKKWSLDDFEIGRPLGTGKFGRVYLAREAKS
KFIVGIKVLNKAQLQKASIEHQLRREIEIQSHLRHPNIIRLYGYFYDATRIYLIIEYAAR
GELFSILRDAGRFDEHTAAEYIVQMCDAIDYCHSKHIIHRDIKPENILVGLNGELKIADF
GWSVHAPTSRRTTLCGTLDYLPPEMIEGYDHDNSVDIWSLGVLLYEFLVGEPPFETDSQR
NTCRRIINVDIRFPSFVTPLARDLILRFLQKDPAKRMPLSQVRSHPWIVQQLGPAPK
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgagtattgccaaggaaaatatctccccgtccaacactccaattgctaaatcaccacgc
aggaatggtcaggctagtcgttcacaagtaaagaagtggtcccttgacgattttgagatt
ggtcgcccacttggtacaggtaaatttggacgagtttacctcgctcgtgaagctaaatct
aagttcattgttggcatcaaagttcttaacaaagctcagcttcaaaaggcttctattgag
catcagctccgtcgcgaaatcgaaatccagtctcatcttcgtcatccaaatatcatccgc
ctatatggatacttttatgatgctacaagaatctatcttattattgaatacgctgctcgc
ggtgagttattttctattctccgcgatgcaggcagatttgacgagcatacagcagctgaa
tacattgttcagatgtgtgatgctattgattactgccattcaaagcacattatccaccgt
gatatcaaaccagaaaatattcttgtcggattgaacggagaactcaaaatcgcagatttc
ggctggtcagttcatgctccaacatcccgtcgtacaactctttgcggtacacttgactac
cttccaccagaaatgattgaaggttatgatcatgataactctgttgatatttggagcctt
ggtgtcctcttatacgaattcttggtaggtgagccaccgtttgagacagactctcaacgc
aacacatgccgtcgtatcattaatgttgatatccgcttcccatcatttgttacccctctt
gctcgcgatttgatcttacgtttcctccagaaggatccagctaagagaatgccactttct
caggtccgttcccatccatggattgttcaacagcttggcccggcaccaaagtaa

DBGET integrated database retrieval system