KEGG   Trichomonas vaginalis: TVAG_308330Help
Entry
TVAG_308330       CDS       T01022                                 

Definition
acetyltransferase, GNAT family protein
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
tva  Trichomonas vaginalis
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 359 aa AA seqDB search
MKKLFSPPKPSMGKSSSFKNPWIEEDTNSKIIGYKKLNVSDIITNFETDSKASKMEELKD
ELQFRIIRNDNCSQSLMWLLEARNIFMCQLSNMSQDYISELVFNRYHKTLIIIYQGVVVG
GICFREFEKFAEIAFCAVGNKFHINGFGSYMMALFKTYLQTVGILNIFTYGDDTALVFFH
RHGFSKHTGLQSSEWKGYLKDYVNATLLTCKINPQIDYTMIHAALDAMLNTIEKELGMSK
INRVTEFPFTRIEGFMVDQRPNRVVEDKNMSAAFAALLNYSKADLFWKVPQQELGSEYSL
SKVYKNLIKNTYHSYEEFSNDVIKVFQSVIDNSPDTNTFTKAAKKVIEKAQEILQKYKP
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaattattttccccaccaaaaccttcaatggggaaatcatcatcattcaagaat
ccatggatcgaagaagatacaaattcaaaaataataggttataagaagttaaatgtctca
gatatcattacaaattttgaaactgattcaaaagcaagtaaaatggaagaattaaaagat
gaattacaatttagaatcatacgaaatgataattgctctcaatcattgatgtggttacta
gaagcaagaaatattttcatgtgccagctatcaaacatgtcacaagattacatatctgag
cttgttttcaatcgttatcataaaactcttatcattatttatcaaggcgtcgttgttggc
ggaatttgttttagagaattcgaaaaatttgcagaaatagcattttgtgcagtcggaaac
aagtttcatatcaatggttttggctcatacatgatggcactttttaaaacttacttacag
acagttggaattcttaatatttttacatatggcgatgatacagcattagttttctttcac
agacatggattctcaaaacatactggcttacagtcttctgaatggaaaggatacttaaaa
gattacgtaaatgcaactttactaacatgcaagattaatcctcaaatagattacacaatg
atacatgcagctcttgatgcaatgcttaatacaatcgaaaaagagctcggtatgagtaaa
attaacagagtaacggaatttccttttaccagaattgaaggttttatggttgaccaaagg
ccaaatcgtgttgtcgaagataaaaatatgtctgctgctttcgccgcacttttgaattat
tccaaagctgatttgttttggaaagtaccacaacaagagctgggttcagagtattcatta
tctaaggtttataaaaatctaattaagaatacttatcattcttatgaagaattttcgaat
gatgtgatcaaagtatttcagtcagttatagataattcgcctgacacaaatacattcact
aaagcagccaagaaagttattgaaaaagcccaagaaattttacaaaaatacaaaccatag

DBGET integrated database retrieval system