KEGG   Trichomonas vaginalis: TVAG_308330Help
Entry
TVAG_308330       CDS       T01022                                 

Definition
(RefSeq) acetyltransferase, GNAT family protein
  KO
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
tva  Trichomonas vaginalis
Brite
Enzymes [BR:tva01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     TVAG_308330
Transcription machinery [BR:tva03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     TVAG_308330
Chromosome [BR:tva03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    TVAG_308330
   HAT complexes
    PCAF complex
     TVAG_308330
    STAGA complex
     TVAG_308330
    TFTC complex
     TVAG_308330
    SAGA complex
     TVAG_308330
    SLIK complex
     TVAG_308330
    ADA-HAT complex
     TVAG_308330
    HAT-A2 complex
     TVAG_308330
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 359 aa AA seqDB search
MKKLFSPPKPSMGKSSSFKNPWIEEDTNSKIIGYKKLNVSDIITNFETDSKASKMEELKD
ELQFRIIRNDNCSQSLMWLLEARNIFMCQLSNMSQDYISELVFNRYHKTLIIIYQGVVVG
GICFREFEKFAEIAFCAVGNKFHINGFGSYMMALFKTYLQTVGILNIFTYGDDTALVFFH
RHGFSKHTGLQSSEWKGYLKDYVNATLLTCKINPQIDYTMIHAALDAMLNTIEKELGMSK
INRVTEFPFTRIEGFMVDQRPNRVVEDKNMSAAFAALLNYSKADLFWKVPQQELGSEYSL
SKVYKNLIKNTYHSYEEFSNDVIKVFQSVIDNSPDTNTFTKAAKKVIEKAQEILQKYKP
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaattattttccccaccaaaaccttcaatggggaaatcatcatcattcaagaat
ccatggatcgaagaagatacaaattcaaaaataataggttataagaagttaaatgtctca
gatatcattacaaattttgaaactgattcaaaagcaagtaaaatggaagaattaaaagat
gaattacaatttagaatcatacgaaatgataattgctctcaatcattgatgtggttacta
gaagcaagaaatattttcatgtgccagctatcaaacatgtcacaagattacatatctgag
cttgttttcaatcgttatcataaaactcttatcattatttatcaaggcgtcgttgttggc
ggaatttgttttagagaattcgaaaaatttgcagaaatagcattttgtgcagtcggaaac
aagtttcatatcaatggttttggctcatacatgatggcactttttaaaacttacttacag
acagttggaattcttaatatttttacatatggcgatgatacagcattagttttctttcac
agacatggattctcaaaacatactggcttacagtcttctgaatggaaaggatacttaaaa
gattacgtaaatgcaactttactaacatgcaagattaatcctcaaatagattacacaatg
atacatgcagctcttgatgcaatgcttaatacaatcgaaaaagagctcggtatgagtaaa
attaacagagtaacggaatttccttttaccagaattgaaggttttatggttgaccaaagg
ccaaatcgtgttgtcgaagataaaaatatgtctgctgctttcgccgcacttttgaattat
tccaaagctgatttgttttggaaagtaccacaacaagagctgggttcagagtattcatta
tctaaggtttataaaaatctaattaagaatacttatcattcttatgaagaattttcgaat
gatgtgatcaaagtatttcagtcagttatagataattcgcctgacacaaatacattcact
aaagcagccaagaaagttattgaaaaagcccaagaaattttacaaaaatacaaaccatag

DBGET integrated database retrieval system