KEGG   Trichomonas vaginalis: TVAG_330630Help
Entry
TVAG_330630       CDS       T01022                                 

Definition
Amylo-alpha-1,6-glucosidase family protein
Orthology
K01196  
glycogen debranching enzyme [EC:2.4.1.25 3.2.1.33]
Organism
tva  Trichomonas vaginalis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tva00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    TVAG_330630
Enzymes [BR:tva01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     TVAG_330630
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.33  amylo-alpha-1,6-glucosidase
     TVAG_330630
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1469 aa AA seqDB search
MKPLTLRLNNDGGVEIGIIRISAPDHTLNVVVPIGTDFHSPTTILETNHPSKTAKTQTIS
QSKDYSCMEDIVFSIPLTIPGAFVLKLKNATNVGPAVHFIVDPVITINNKKVPASGLNIQ
TNYGRCIGTLDKWLENLTPISKIGYNMIHLPPFQELGHHSHYSIKDQLQISKYLLPKGFD
KSKAWNLFTKTVKEIESKLNIVFMVDIVLNHTNQDSPRLSDHPEAGYNEENSPHLIPAIY
LDNLLNELSNEIAAGKVENLPPDLPASKRDELYNFLRKRILESDFARFFTIDEKKAIETL
ANSDDSNLTKSMEMLRMRSLNYGSPQRLNILRTRGVINEGTYKMDSIHIDNSYAMALFKF
PGRTDESRLHEFELAIKTINAPFVQHFENLVNDVVTAIVNGFCYNRYDPNGPKLGPITVK
TPISWRYFTPITAFKGTKQEKLLHLANNGWLFGAKPTEDFISKNSEAYLRRQVVIWGDCV
KLRYGDKPEDNPWLWSYMQKYVESVARVTHGIRLDNAHSTPLNVAEYFIQKARDVNPSLY
IMAELFTGGEDEDIKYINHIGINSILREAFHNLAPDKLSHMLWLSGGRPVAAIDPLDTES
ILRPLRQIPGVIFDLTHDNPTPYFDRLSAAAAITMASSPIATTRGFDEYLNFNPSVVEEF
RIYPHTDKPVGIQAARLFFNELHTKMAVNGLDELMAHYHGNLLSLFRYNSHTGVGVWMVT
RTSNDNWVNELECLAPIKNLIFEARTASVKYNDSTEEEIIPGDVDVEINTNFKKMKFCEI
RNNSHLVLNDFPVGAVVAFSTQLPQPQLQLLKDLEVRKLADDLVKWTSQLSFADLSILMF
RCGAEEGAQIGTGSYSFPQYGPCFYAGTQGILTAFDSSKDMGSPIFQNMRDGNWLCDFMI
KRLYQAPHLIPILNFMRGKLDKIITLPRFTIPKYIDRLIRALDIFGREQLVRNMSNFVKN
GDDFVQSLAFSSVALYGPVRDAPLINSTLSKIFDDTLVERQDCCLAAGLPHFSSGYMRSW
GRDTFISLRGIFMTTGRFTEARDHLIAFGACLRHGLIPNLHDSCLNPRYNARDATWWFLQ
ALQDYALMAPDGKEVFTWKVPQLFPTDDQQQFERRWAGKQTRPIRTMADVVMDIMTRHAN
GIHFVEWNAGTKIDSVMVEHGFHINIVTDWSNGFILGGNCDNCGTWMDKMGSSTWAKNSG
VPSTPRDGAAIEIIGLLASTLRWLSEENKAGRFPYDGVNVEESGKKITFNEWHSILAANF
ESWFYIPADASEDDKYFIEHSFVSVRGIYKDTVGASNEFGDYQFRPNVPIAMTVAPELFD
PRHAIHCLNLVEERLMGKIAMKTLDSADWRYNPYYENSVDNDNFYSAKGANYHNGPEWVW
PTGYFFRASMKMSRGVTPGMTKMLANIKSYLLNSWAKGLPELTNLNGAVCNDSCVTQAWS
IAAILDILYDHNGYSKEDVTKWSAAERLD
NT seq 4410 nt NT seq  +upstreamnt  +downstreamnt
atgaagcctttaacactcagactgaacaatgatggcggagttgagatcggcatcatccgt
atctccgctcccgatcacactctaaacgtcgttgttccaatcggtacagattttcattcc
ccgacaacaattcttgaaaccaatcatccatctaaaacagctaaaactcagacaatatct
cagagtaaggattacagctgcatggaggatattgtgttttcaattccacttacgattcct
ggtgcatttgttctcaagttgaagaatgcaaccaatgtcggaccagcagtccattttatc
gttgacccagtcattactattaacaataagaaggttcctgcaagtggcttaaacatacaa
acaaattatgggcgctgcatcggtactctcgataagtggcttgaaaatttaacgccaatt
tccaagatcggatacaacatgatccatctcccacctttccaagaacttggccaccattct
cactactctattaaggaccaactccaaatcagcaaataccttcttccaaagggctttgat
aagtccaaggcctggaatttatttacgaaaacagtcaaagagatcgaatctaagctcaat
atcgtttttatggttgatatcgttctcaaccacacaaatcaagattctccacggctctct
gaccacccagaagccggctacaacgaagagaactctccacaccttattccagcaatttat
ctcgataatctcttaaacgagctttccaacgagatcgcagctggcaaagtcgagaatctt
ccaccagatcttccagcatccaagcgcgacgagctctacaacttccttcgtaaaagaatc
ttggaaagtgacttcgctcgcttctttacaattgacgagaagaaggcaatcgaaacattg
gccaactccgacgattccaatctcacaaagagcatggagatgctccgcatgagatcatta
aactacggatctccacagcgcctcaacattctccgcacacgcggtgtcatcaatgaggga
acatacaagatggactcgatccatatcgataacagctacgcaatggcacttttcaagttc
cctggtcgtactgatgaatctcgcctccacgagttcgagcttgccatcaagacaatcaac
gctcctttcgtacagcatttcgaaaacctcgtcaacgatgttgttactgcaattgtcaac
ggattctgctacaatcgctacgatccaaacggtccaaagcttggccctatcacagtcaag
acaccaatctcatggcgctacttcacaccaattacagccttcaaaggaacgaaacaagaa
aaattattacatctcgccaacaacggatggctcttcggtgccaagccaacagaagatttc
atctccaagaacagcgaagcatacttacgcagacaagtcgtcatttggggcgattgcgtc
aaattacgttacggagacaagccagaagacaatccatggctctggagctacatgcagaag
tacgtagagtcagttgcccgcgttactcatggcatcagactcgacaatgcccactcaaca
ccattaaacgtcgcagagtacttcattcaaaaagcccgtgatgtaaatccaagcctgtac
atcatggccgaactctttacaggcggcgaagatgaagatatcaagtacatcaaccacatt
ggtatcaattccattctccgcgaggccttccacaacctagcacccgacaaactctcccac
atgctctggttatccggtggccgccctgttgccgctatcgatcctctcgatacagaatca
atattacgtccacttcgccagattccaggtgttatcttcgatcttacacacgacaacccc
acaccatatttcgacaggttgtcagccgccgcagccatcacaatggcctcatcaccaatt
gctacaacacgaggattcgacgaataccttaatttcaatccatcagttgttgaagagttc
agaatctatccacacacagacaaaccagttggcatccaagccgccagactcttcttcaac
gagttgcacacaaaaatggctgttaatggattggatgaactcatggctcactaccacgga
aatctcctttctctcttcagatacaactctcacacaggtgttggagtatggatggtcaca
agaacatcaaatgacaactgggtgaatgagttagagtgtcttgctccaataaagaacttg
attttcgaggcaagaacggcatcagtcaaatacaatgattcgactgaagaagagattatt
ccaggagatgtcgatgtagaaatcaacactaatttcaagaagatgaaattctgcgagatc
agaaacaactcacatttagttctcaacgatttccctgttggcgctgttgttgctttctca
acacaactccctcagccacagctccaactcctcaaggacttagaagtgagaaaactcgct
gatgacttagtcaaatggacatcacagctttctttcgctgatctctcaatcctcatgttc
agatgcggtgcagaagaaggcgcacagataggaacaggcagctactcattccctcagtac
ggaccatgtttctatgctggtacacaaggtattttgactgcatttgattcatcgaaagac
atgggaagtccgatcttccagaacatgagagatggaaactggttatgtgacttcatgatc
aagagattgtatcaggcaccacatctcattccaattctcaacttcatgagaggaaagctt
gataagatcatcacattgccaagattcacaattcctaagtacatcgacagattgatcaga
gctctcgacatcttcggaagagaacaactcgtcaggaacatgtccaattttgtaaagaat
ggcgatgatttcgttcaatcactcgctttctcaagtgtcgctttgtacggcccagtcaga
gatgctcctttgattaactctacactctcaaagatattcgatgacacgttagttgagaga
caggattgttgcttggccgctggtttaccacacttctcaagcggatacatgagatcgtgg
ggcagagacacattcatctctttgagaggcatcttcatgacaacaggaagattcactgaa
gcacgcgatcacttgattgcattcggtgcttgtttgagacatggtttgattccaaatctc
catgattcatgtcttaatccacgctacaacgcaagagatgcaacatggtggttcttgcaa
gcactccaggattacgcactcatggctccagacggaaaggaagttttcacatggaaagtt
cctcagctgttcccaacagatgaccagcagcagttcgagagaagatgggctggaaagcag
acaagaccaatcagaacaatggccgatgttgtcatggacatcatgacaagacacgcaaac
ggaattcacttcgttgaatggaatgcaggaacaaagattgattccgtaatggtcgaacac
ggcttccacatcaatatcgtcactgattggtcgaatggcttcattctcggcggaaactgc
gacaactgcggcacatggatggacaagatgggatcatcaacatgggcaaagaacagcggt
gtcccatcaacaccaagagatggtgctgcaatcgaaatcatcggtttgctcgcttcaaca
ctcagatggctcagcgaagaaaacaaggcaggaagattcccatacgacggtgtcaatgtt
gaagagtccggaaagaagattactttcaacgaatggcactcaatcctcgctgcaaacttc
gagagctggttctacatcccagctgatgcttcggaagatgacaagtacttcatcgaacac
agtttcgtttctgtcagaggaatctacaaagatactgttggcgcttcaaacgaattcggt
gattaccagttcagaccaaatgttccgatcgctatgacagttgctccagagttattcgac
ccacgccacgcaatccactgcttgaacttggtcgaggagagactcatgggaaagatcgca
atgaagacactcgattcagcagattggagatacaacccttactacgaaaactcagtagat
aatgacaatttctactcagcaaagggagcaaactaccacaatggccctgaatgggtttgg
ccaacaggctacttcttcagagcttcaatgaagatgtcaagaggtgtaacaccaggaatg
acaaagatgctcgcaaacatcaagtcatatttgctcaattcttgggctaaaggtctccca
gaattgacaaacttaaacggtgctgtttgcaatgattcctgcgtaactcaagcatggtct
atcgctgccattcttgatatcctctacgaccacaatggatactcaaaggaagatgttaca
aaatggtcagctgcagaaagattagattag

DBGET integrated database retrieval system