KEGG   Trichomonas vaginalis: TVAG_338030Help
Entry
TVAG_338030       CDS       T01022                                 

Definition
CMGC family protein kinase
Orthology
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
tva  Trichomonas vaginalis
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 365 aa AA seqDB search
MNEDTKHIIAELEEVTEGRYEIKRRLGRGAYGVVFAAKDKKTKKMVAIKKVEHIFDTLLD
AKRCLREVCILSHFNHDNITNLIDVTSPSDYNKFNYLIIIMDLMETDLHRIISSNQPITV
EHHRFFIYQILRGLKYIHSANVLHRDLKPANILVNANCDLKITDFGLARVSELNDDSDFL
SEYVATRYYRPPEVLLNYNTYGPALDVWSVGCILAEMILRRPLLPGKNTLDQIALIVNLI
GSPSEQDLEECPAQNAKKYVQSLGEKKKVAWKTIFRGKLYIDEELDLLDRMLTWDPRKRI
TVDEALEHPFLNSLHDPTDEPETFPLEEFEFETDKIHLRDLKRRLWEEVIQYHPEFGEAP
PVKET
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaagatacaaagcatatcatagcagaacttgaagaagtaaccgaagggcgttat
gaaattaaacgtcgattaggaagaggtgcatatggagttgtttttgcagcaaaagataag
aaaactaaaaagatggttgccatcaaaaaagttgaacacatctttgatacacttttagat
gcaaaaagatgtcttcgtgaagtgtgcatactttcgcatttcaatcatgacaatataacg
aatttaattgatgtcacatcaccttcggactacaacaaattcaattacttaattatcatc
atggatttaatggaaaccgatttgcatcgtattattagtagtaatcaacctattacggtt
gaacatcatagatttttcatttatcaaatccttcgaggtcttaaatacattcattccgca
aatgtactccatagagacttgaaacctgctaatattcttgtaaacgcaaactgtgattta
aagattacagatttcggtcttgccagagtaagcgagttaaacgatgatagcgatttcctt
tctgaatacgtggccactagatattacagacctccggaagttcttttgaattataatact
tatggacctgctcttgatgtttggagcgttggctgtatccttgctgaaatgattcttaga
agacctttattaccgggtaagaatactctcgatcagattgctttaattgtgaatttaatt
ggatctccttcagaacaagatttagaagaatgtccagctcaaaacgcaaagaaatacgta
caaagtcttggtgagaaaaagaaagttgcatggaaaacaattttcagaggtaaattatac
attgatgaagagttagaccttcttgatagaatgcttacatgggatccacgcaagagaatc
actgttgacgaggctttggagcatcctttcttaaattcattacatgatccaacagatgaa
ccagaaacattccctcttgaagaattcgaatttgaaacagataaaatacacctcagagac
ctgaaaagaagactctgggaagaagttattcaatatcatcctgaatttggagaggcacct
cctgttaaggagacctaa

DBGET integrated database retrieval system