KEGG   Trichomonas vaginalis: TVAG_343960Help
Entry
TVAG_343960       CDS       T01022                                 

Definition
Eukaryotic initiation factor 4E family protein
Orthology
K03259  
translation initiation factor 4E
Organism
tva  Trichomonas vaginalis
Pathway
RNA transport
Class
Genetic Information Processing; Translation; RNA transport [PATH:tva03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 189 aa AA seqDB search
MSHPLASPWTFYLYATNKAERAAKDYLQCIQKIAKVNTVEDFRAVYSHTIPPSRLKPNTA
LHFFRGDHRAVREDKENENGGTFFIKLLRNHASQEWKKLLLDFISESINEDVIGAVVSVR
NDNERILVWNKTSSDPTIRLAIANQLAKCLNLPFKSRIEYLAHQRIGNSKPIMYIIEAEG
AVEQHTSSK
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgagtcatcctcttgcaagcccatggacattttatctttatgctacaaacaaagcagaa
agagcagcgaaagattacttacagtgcattcaaaaaattgctaaagttaacacagttgaa
gattttcgggcagtctattcacatacaattcctccatcgagactgaaaccaaatacagct
cttcacttctttagaggtgaccatagagctgttcgtgaagataaagaaaacgaaaatggt
ggaacatttttcattaagcttttaagaaatcacgcttctcaagaatggaagaaattactt
ctagattttatatcagaaagtattaatgaagatgttattggagctgttgtatcagttcga
aatgataatgagcgtattcttgtttggaataagacttctagtgatcccacaattcgttta
gcaatagctaatcaacttgctaaatgtttgaatcttccatttaagagtagaatagaatat
cttgcccaccaaaggattggtaactcaaaaccaataatgtatatcatagaggcggaaggt
gccgttgagcagcatactagtagtaagtaa

DBGET integrated database retrieval system