KEGG   Trichomonas vaginalis: TVAG_353000Help
Entry
TVAG_353000       CDS       T01022                                 

Definition
glycerol kinase family protein
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
tva  Trichomonas vaginalis
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tva00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    TVAG_353000
Enzymes [BR:tva01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     TVAG_353000
Exosome [BR:tva04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   TVAG_353000
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 501 aa AA seqDB search
MSLIGSVDQGTSSTRFTVYAPSGEVITGHQTPVSRTTPKPGWVEQDPLEIINSVRVCLNA
VATKLESMDRSPKDVIAIGITNQRETLVIWEKFTGRPLYNAIVWCDARNADVVDELAKKY
GGTNAFAEKTGLPLSTYFTATKLLWLRKNVPEVQKALDEKTCLIGTIDTWITWCLTGGHT
HVTDVTNASRTMLLDIQKLEWDNEMLKVFGIPRQVLPKVVSSAEVYGCVTDEYGAFEGCA
ISGMLGDQQASLVGTKCMRKGTAKITYGTGCFLLCNTGETPEFSKSGLITTVGYKLGRRS
PVCYALEGSVATCGMAVQWLNDILGKSETISELASSVEDSGGVYFVPAFSGLLCPYWKPD
ARGTFMGITGYTQRGHFARAVLEGIAFQASDVLACIDIPLNEVRVDGGLSRSDLLLQFQA
DLLNIDVLRGANVEATSKGAAIAAAYGIGMAGAGIITGDEECKTFSPMVSDRKRSFKLKM
WKKAIQRSMDWLEQEEEDESD
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgtctcttattggctctgttgatcagggaacttcatcaacacgttttacagtatatgca
ccatcaggtgaagttatcacaggccatcaaactccagtttcaagaactactccaaagcca
ggatgggttgaacaagatccacttgaaatcattaacagtgttcgagtctgtcttaatgct
gtagcaactaaactcgaatctatggatcgatcaccaaaagatgttattgcaattggcatt
acaaatcaaagagaaacactcgttatttgggagaaattcacaggaaggccgctttataat
gcaattgtttggtgtgatgcaagaaacgctgatgtagttgatgaacttgccaaaaaatat
ggcggaacaaatgcatttgccgaaaaaaccggtcttccactttctacatactttacagcc
actaagcttttatggcttcgcaagaatgtgccagaagttcagaaggctctcgatgaaaaa
acttgtttaatcggaaccatcgatacttggattacttggtgccttacaggtggtcatact
cacgttaccgatgttactaatgcatcaagaacgatgctccttgacattcagaagcttgaa
tgggataatgaaatgttaaaagttttcggaatcccacggcaagttcttccaaaagttgtc
tcttcagccgaagtttatggatgtgttactgacgaatacggagcttttgaaggttgcgcg
atttccggaatgttaggtgaccaacaagcttcattagtaggaacaaaatgcatgcgaaaa
ggaacagcgaaaattacatacggaactggctgcttcttgctctgtaatacaggtgaaact
cccgaattctcaaaaagtggcttaattacaacagttggatacaaactaggccgcagatca
ccagtctgctacgctctagaaggctctgtcgctacctgcggcatggctgttcaatggctg
aacgacattttaggcaaatcagaaacaatttcagaacttgcctcttctgtcgaagacagt
ggtggtgtatactttgttccagcattctcaggacttctttgtccgtactggaagccagat
gctcgaggtacatttatgggaattactggttacacacaacgcggccactttgcaagggca
gtacttgagggcattgccttccaagcatcagatgtccttgcctgcatcgatatcccgctc
aacgaagttagagttgacggaggattgtcgagatctgacttgttactccaattccaggca
gatctgctcaacatagatgtactcagaggtgcaaacgtagaggctacatcgaaaggagca
gcaattgccgctgcttacggaatcggaatggccggagcaggaattattactggagacgag
gaatgcaagacattctctccaatggtgtcggatagaaaacgatcattcaagctcaaaatg
tggaagaaagctatccaaagatctatggattggcttgaacaagaggaagaagatgaatcg
gattaa

DBGET integrated database retrieval system