KEGG   Trichomonas vaginalis: TVAG_359840Help
Entry
TVAG_359840       CDS       T01022                                 

Definition
(RefSeq) MOZ/SAS family protein
  KO
K11308  histone acetyltransferase MYST1 [EC:2.3.1.48]
Organism
tva  Trichomonas vaginalis
Brite
Enzymes [BR:tva01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     TVAG_359840
Chromosome [BR:tva03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    TVAG_359840
   HAT complexes
    NSL complex
     TVAG_359840
    MSL complex
     TVAG_359840
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MOZ_SAS Tudor-knot zf-C2H2_4 Peptidase_M60
Motif
Other DBs
NCBI-GeneID: 4774384
NCBI-ProteinID: XP_001328598
UniProt: A2DTA3
AA seq 381 aa AA seqDB search
MNPKTIHVGDRVVVYCEQYQQLMEAIVVGAKVSTKQLYIHYVHQDKRLDRWISVKEVTDD
PNVVIKTKAGKSAIRNHKILNTDELDVEKLAVEYKQFEKAHQEVTRIRNIDRITIGPYTI
QAWYYSPYPNPFGKMEHLYICDHCFQYFASAEELAKHLQVTGEKCPPGNEIYRQGNLSIF
EMKGMVNKVPCQCLCLLSKLFLDHKTLFYDVEGFNFYVVCECDDNGAHIAAYFSKEVNSS
AYNVLSCITTLPPYQKKGYGNLCISLSYELARRSRMSGGPERPLSDLGKLAFASYWKDTL
LEMFSTRLSEMTSIDNIVILTSIQKLDVIETLKQINCLTRVKGDYEIDLHSPQLKQAIEA
HQKVPPKRRIDPQYLTWIPEA
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgaatccgaaaacaattcatgtaggtgaccgtgttgttgtttattgcgaacaatatcag
cagctgatggaagcaattgttgttggagcaaaagttagtacaaaacaactttatattcat
tatgttcatcaagataaaagacttgatcgatggatttctgtaaaagaagtcaccgatgat
ccaaatgtcgtaataaaaacaaaagctggtaaatctgcaataagaaatcacaaaatttta
aataccgacgaacttgacgttgaaaaactcgcagtagagtacaaacaattcgaaaaggcc
caccaagaagttacccgtattcgaaacatcgataggattacaattgggccatatacaatt
caagcttggtattattcgccatatcctaatccttttggaaaaatggagcacttatatata
tgtgatcactgtttccaatattttgctagcgcagaagaactcgcaaagcacttgcaagtt
acaggagaaaaatgtccaccaggaaatgagatttatcggcaaggaaatctcagtatcttc
gaaatgaaaggaatggtaaacaaagttccgtgccagtgcctctgtttactttcaaaatta
tttttggatcacaaaactttgttttacgatgttgaaggcttcaatttctacgtagtatgc
gaatgtgatgataacggtgctcacattgccgcatatttctcaaaggaagtcaatagtagc
gcatataatgttttatcttgcattacaactttaccaccttaccaaaagaaaggctacgga
aacctttgtatatccttaagctacgagctggccagacgctccagaatgagcggtggccca
gaaagacctttatctgatcttggaaaactcgcattcgcttcttattggaaggatacgctt
ttggagatgttcagtacaagactttccgaaatgacttctattgataatatcgttatcctt
acaagtattcaaaaactcgacgtaatcgagacattaaagcaaattaactgcttgacaagg
gtaaaaggcgattatgagattgatcttcattcaccacagttgaaacaagcaatagaagct
catcagaaagtcccgccaaagagaagaattgatcctcagtatttaacttggattccagaa
gcataa

DBGET integrated database retrieval system