KEGG   Trichomonas vaginalis: TVAG_359840Help
Entry
TVAG_359840       CDS       T01022                                 

Definition
MOZ/SAS family protein
Orthology
K11308  
histone acetyltransferase MYST1 [EC:2.3.1.48]
Organism
tva  Trichomonas vaginalis
Brite
Enzymes [BR:tva01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     TVAG_359840
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 381 aa AA seqDB search
MNPKTIHVGDRVVVYCEQYQQLMEAIVVGAKVSTKQLYIHYVHQDKRLDRWISVKEVTDD
PNVVIKTKAGKSAIRNHKILNTDELDVEKLAVEYKQFEKAHQEVTRIRNIDRITIGPYTI
QAWYYSPYPNPFGKMEHLYICDHCFQYFASAEELAKHLQVTGEKCPPGNEIYRQGNLSIF
EMKGMVNKVPCQCLCLLSKLFLDHKTLFYDVEGFNFYVVCECDDNGAHIAAYFSKEVNSS
AYNVLSCITTLPPYQKKGYGNLCISLSYELARRSRMSGGPERPLSDLGKLAFASYWKDTL
LEMFSTRLSEMTSIDNIVILTSIQKLDVIETLKQINCLTRVKGDYEIDLHSPQLKQAIEA
HQKVPPKRRIDPQYLTWIPEA
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgaatccgaaaacaattcatgtaggtgaccgtgttgttgtttattgcgaacaatatcag
cagctgatggaagcaattgttgttggagcaaaagttagtacaaaacaactttatattcat
tatgttcatcaagataaaagacttgatcgatggatttctgtaaaagaagtcaccgatgat
ccaaatgtcgtaataaaaacaaaagctggtaaatctgcaataagaaatcacaaaatttta
aataccgacgaacttgacgttgaaaaactcgcagtagagtacaaacaattcgaaaaggcc
caccaagaagttacccgtattcgaaacatcgataggattacaattgggccatatacaatt
caagcttggtattattcgccatatcctaatccttttggaaaaatggagcacttatatata
tgtgatcactgtttccaatattttgctagcgcagaagaactcgcaaagcacttgcaagtt
acaggagaaaaatgtccaccaggaaatgagatttatcggcaaggaaatctcagtatcttc
gaaatgaaaggaatggtaaacaaagttccgtgccagtgcctctgtttactttcaaaatta
tttttggatcacaaaactttgttttacgatgttgaaggcttcaatttctacgtagtatgc
gaatgtgatgataacggtgctcacattgccgcatatttctcaaaggaagtcaatagtagc
gcatataatgttttatcttgcattacaactttaccaccttaccaaaagaaaggctacgga
aacctttgtatatccttaagctacgagctggccagacgctccagaatgagcggtggccca
gaaagacctttatctgatcttggaaaactcgcattcgcttcttattggaaggatacgctt
ttggagatgttcagtacaagactttccgaaatgacttctattgataatatcgttatcctt
acaagtattcaaaaactcgacgtaatcgagacattaaagcaaattaactgcttgacaagg
gtaaaaggcgattatgagattgatcttcattcaccacagttgaaacaagcaatagaagct
catcagaaagtcccgccaaagagaagaattgatcctcagtatttaacttggattccagaa
gcataa

DBGET integrated database retrieval system