KEGG   Trichomonas vaginalis: TVAG_365600Help
Entry
TVAG_365600       CDS       T01022                                 

Definition
beta-galactosidase
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
tva  Trichomonas vaginalis
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:tva00052]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:tva00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:tva00511]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 804 aa AA seqDB search
MHLMLAAFAAFSRSSDRTEIQFEKGWKFQRGDCADANKIDFDDHAWETVRVPHDWAIAGP
FDHHNDLQDVVVSQNFETEPSMKTGRTGGLPYVGAGWYRYYFKADATKNNTLLFDGAMSE
AHVYLNGELVCNWPYGYNSFFCDITDHVNKDGKDNVLAVRLQNHPQSSRWYPGAGIYRNV
HLITTNKIHVPVWGTHVTTPRAEADYSTMNLRTTLAGVNGETIKVVTKIFDPSGKEYMVN
DKYTQDGNDYVQDFTVNTPALWSPETPNVYTAQTTISANDVEVDTYPTTFGFRKVEFIKD
KGMFLNGVSRKFQGVCNHHDQGPLGTAVNDKAIHHQLEILKDMGADSIRTSHNMPAPELV
KACDEMGFMMIVEAFDEWDWAKCNNGYHRFFNEWAEKDIVNMVRHYRNHPSVILWSVGNE
IPNTCSNEALAVVKKLVSWCHREDSTRLVTCGTDQVQCSIYSGFAAALDIPGFNYRSFLY
QEAYEHLPQGYILGTETGSTVSSRGVYKLPAIKRATAIYPDHQSTGYDYEFCGWSNVPED
DFEMADDYEWTLGQFVWTGLDYLGEPTPYDTNGWPSHSSVFGIIDLAYIPKDRYYLFRTV
WNKKDHTLHMLPHWNWEGYEGQVVPVMVYSDYPQVELFINGASFGKMKRGNTSLQTRYRY
QWMNAVYQPGNIRAVAYDEHGNQVGSVQINTAGTPHHLKVETKHTSLKADGKDVAYITVS
VVDANGNLCPHDDREISFRVKGAGNFKGAANGNAASVDFFQRPRIHAFAGMLTAVVQTTE
EAGDIIFEASAKGLKSGTVTMTSK
NT seq 2415 nt NT seq  +upstreamnt  +downstreamnt
atgcatctaatgcttgctgcttttgcagcattcagtagatcatcagatcgtacagaaata
cagttcgaaaaaggatggaaattccaaagaggtgactgcgcagacgcaaataaaattgac
tttgatgatcatgcttgggaaacagttcgtgttcctcacgattgggctattgctggtcca
ttcgatcatcacaatgacttgcaagatgtcgttgtctctcaaaactttgaaacagaacca
tcaatgaaaacaggccgtacaggtggtcttccatatgttggtgcaggctggtatagatac
tatttcaaggctgatgctacaaagaacaatacattattattcgatggtgcaatgagtgaa
gctcacgtttatcttaacggtgaactcgtttgcaactggccatacggttacaactctttc
ttctgcgatatcacagatcacgttaataaggatggcaaagataacgttctcgctgttcgc
ttacagaaccatcctcagtcctctcgctggtatccaggtgccggtatctaccgtaatgtt
catcttataaccacaaataagatccatgttccagtttggggcactcatgtcacaacacca
cgcgctgaagctgattattcaacaatgaatctccgtacaacacttgctggcgttaatggc
gagacaatcaaagttgtcacaaagatttttgatccatcaggcaaagaatacatggtaaat
gataagtacacacaggatggaaacgactatgtccaagatttcacagttaacacaccagct
ctttggtcaccagagacaccaaatgtttacacagcccagacaacaatttctgccaacgac
gttgaagttgatacatacccaacaacatttggcttccgcaaagtcgaattcatcaaggac
aagggcatgttcctcaatggtgtaagtcgcaaattccaaggtgtctgcaaccaccacgac
caaggtccattaggtacagcagttaatgacaaggcaatccaccatcaacttgagatcctc
aaggacatgggtgcagactcaatccgtacatctcacaacatgccagctccagaacttgtc
aaggcttgcgatgaaatgggcttcatgatgattgtcgaagctttcgatgagtgggattgg
gctaagtgcaacaatggctaccacagattcttcaatgaatgggctgaaaaagatatcgtt
aacatggttcgccactacagaaatcatccatctgttatcctttggtcagttggtaacgaa
attccaaacacatgctctaatgaagctctcgctgttgtcaagaaattagtttcatggtgc
caccgtgaagattcaacaagattagttacatgtggtacagatcaggttcagtgctccatc
tacagtggcttcgcagctgctttggatattccaggcttcaactacagatcattcctctac
caagaagcttatgaacaccttccacaaggctacatccttggtacagaaacaggctctact
gtttcatcaagaggtgtctacaaacttccagccatcaagcgtgctacagccatctatcca
gatcaccagtcaacaggttacgattacgaattctgcggctggtcaaacgtcccagaagat
gacttcgaaatggctgatgactacgagtggacacttggtcagttcgtttggacaggctta
gattatcttggtgaaccaacaccatatgatacaaacggatggccatcacactcatctgtc
tttggtatcatcgacttggcttacattccaaaggatagatactacttgttcagaacagtc
tggaacaagaaggaccacacactccacatgcttccacactggaactgggaaggctatgaa
ggacaggtcgttccagttatggtttactctgactacccacaggttgaattattcatcaat
ggtgctagcttcggcaagatgaagagaggcaacacatcactccagacaagatacagatac
cagtggatgaacgctgtctaccagccaggtaacatcagagctgttgcttatgatgaacat
ggcaaccaggttggatctgtccagatcaacactgctggtactcctcaccatctcaaggtt
gaaacaaagcacacaagtctcaaggctgatggcaaggatgttgcttacatcaccgttagc
gttgttgatgctaatggaaatctttgcccacatgatgatcgcgaaatttcattccgcgtt
aaaggagctggtaacttcaagggcgccgctaatggtaatgctgcttctgtcgacttcttc
cagcgtccacgcattcatgctttcgctggtatgctcacagctgtcgttcagacaactgag
gaagctggtgatatcatcttcgaggcttctgctaagggactcaagtcaggaacagttaca
atgacatcaaaataa

DBGET integrated database retrieval system