KEGG   Trichomonas vaginalis: TVAG_379750Help
Entry
TVAG_379750       CDS       T01022                                 

Definition
translation initiation factor 4E-related protein
Orthology
K03259  
translation initiation factor 4E
Organism
tva  Trichomonas vaginalis
Pathway
RNA transport
Class
Genetic Information Processing; Translation; RNA transport [PATH:tva03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 182 aa AA seqDB search
MSAKAESIVPIPSDSGKGTPIPNKWVFWYLIPCKGGQNVHWSEYLHPLHSFDTIEGFCKL
LSSIEHLHSLLKGCRYYVFREGVKPLWEDPSVKDGNVVSIEMDKTPENTENIEQKWQDII
IPTLNEELGPDVVGVEFASRETSWRMASWIKKDSKNIDKIFEFYQNALPNLSNLVTVSKV
GN
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atgtctgccaaggccgagagcattgttcctattccatcagattctggtaaaggtactcca
atacctaataaatgggttttctggtacttaattccttgcaaaggaggccaaaatgtccat
tggagcgaatatcttcatccacttcattcattcgatacgattgaaggtttctgtaaactt
ttaagctctatcgaacatttacatagtttgttaaaaggctgcagatattacgttttccgc
gaaggagtaaaaccactctgggaagacccatctgtaaaagatggtaatgtagtatccatt
gaaatggataaaactccagaaaatacagaaaatatagagcagaaatggcaggatatcatt
ataccaacattaaatgaagagcttgggccagatgttgtaggagtcgaatttgcatccaga
gagacttcttggagaatggcatcttggatcaaaaaggactccaaaaatattgataaaatt
ttcgagttttatcaaaacgcgttaccaaatctatcaaatttagtaacagtatcaaaggta
ggaaactag

DBGET integrated database retrieval system