KEGG   Trichomonas vaginalis: TVAG_380920Help
Entry
TVAG_380920       CDS       T01022                                 

Definition
Histone H2B
Orthology
K11252  
histone H2B
Organism
tva  Trichomonas vaginalis
Brite
Exosome [BR:tva04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   TVAG_380920
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 129 aa AA seqDB search
MSSKKPASKTPTEKKPAVEGVDAANAAKQDKKLRHKKRAETFSSYIFKVLKQVHPDIGIS
NKAMMVMNSFVTDIFERIAQEGARLVDMNERNTLGSREVQTAVRLVLPGDLAKHAVSEGG
KAVAKFNAE
NT seq 390 nt NT seq  +upstreamnt  +downstreamnt
atgtcttccaagaagccagcctctaaaacaccaactgagaagaagccagccgtcgagggt
gtcgatgctgccaacgctgctaagcaagataagaagctccgccacaagaagcgtgctgaa
acattctcctcctacatcttcaaggttcttaagcaggtccacccagatatcggtatctcc
aacaaggctatgatggttatgaactccttcgttacagatatcttcgaacgtatcgcccaa
gaaggtgctcgccttgtcgatatgaacgaacgtaacacacttggttcccgcgaagttcag
acagctgttcgtcttgttcttccaggcgatcttgccaagcacgccgtttccgaaggtggc
aaggccgtcgctaagttcaacgctgagtaa

DBGET integrated database retrieval system