KEGG   Trichomonas vaginalis: TVAG_388260Help
Entry
TVAG_388260       CDS       T01022                                 

Definition
UTP--glucose-1-phosphate uridylyltransferase family protein
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
tva  Trichomonas vaginalis
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:tva00040]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:tva00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:tva00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:tva00520]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 465 aa AA seqDB search
MSVASLMATDEKAALQLLREKVAPLKLSKGAEDKLVSMFKAAFSKDSEAEINWDFVKPLT
PNEQFPYENLAEPANPAELLKQLVVVKLNGGLGTTMGCTFPKSLINVADNETFFDITAQQ
VAEFNQKYNVDIPLVLMHSFYTDDLMKPHLNKVKGVRVLTFNQNKFPRIDAETLEPVPTS
PDSPLAEWNPPGHGDVYHCLRDSGLLDQLIAEGKKFMFISNIDNLGARIDLKILNKVATE
NRSYAAETVPKTPDDWKGGMPILYKGRVKLLETAQVPNGHMDDFKNIKIFDIFNSNNMWV
NLVTLKKALDEDTLVLDVIKNRKVYNGRNVIQLEAAAGSAIQSFHDSISIKIPRSRFLPV
KSCNELLMDRSDLYVRNGGEFILSPKRTLTTLPSINLGPKYQHVSEFEKRFKAIPSLLNV
DVLEVTGDVTFGPGVVIEGKVHIKGSDDKPVTIENRHLKDETVTF
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtcgcttctttgatggctactgatgaaaaagctgccctccagctcttaagggag
aaggtagcaccactcaaactctctaagggtgctgaggacaagcttgtttcaatgttcaag
gctgcattctcaaaggattccgaagccgaaatcaactgggacttcgttaagccactcaca
ccaaacgagcagttcccatacgagaaccttgctgaaccagctaacccagctgagctcctc
aagcaacttgtcgtcgttaaattaaacggtggcctcggcacaacaatgggctgcacattc
ccgaagtctcttatcaatgtcgctgacaatgagacattcttcgacatcacagcacagcaa
gttgccgaattcaaccaaaagtacaacgttgatatcccacttgttctcatgcactccttc
tacacagatgacctcatgaagccacacctcaacaaggtcaagggagtccgcgtcctcaca
ttcaaccagaacaagttcccaagaatcgatgccgagactcttgaaccagtcccaacatcc
ccagactcacctcttgctgaatggaacccaccaggccacggcgatgtctaccactgcctc
cgtgattccggattacttgatcagctcatcgctgaaggcaagaagttcatgttcatctcc
aacatcgataaccttggtgccagaattgacctcaagatcctcaacaaggttgctacagag
aacagatcttatgctgctgaaacagttccaaagacaccagatgactggaagggtggcatg
ccaatcctttacaagggccgcgtaaaacttcttgaaacagcccaggttccaaacggccac
atggacgacttcaagaacatcaagatcttcgacatcttcaactccaacaacatgtgggtt
aaccttgtcacactcaagaaggctctcgatgaggatacactcgttctcgatgtcatcaag
aaccgcaaggtttacaacggccgtaacgttatccaactcgaagctgctgctggctctgcc
atccagtcattccatgactcaatctcaatcaagatcccacgttcaagattccttccagtt
aagtcatgcaacgaattactcatggaccgctccgatctctacgtcagaaatggtggtgag
ttcatcctctctccaaagagaacactcacaacactcccatcaatcaaccttggtccaaag
taccagcacgtctcagaattcgagaagagattcaaggctatcccatctctcctcaatgtt
gacgttcttgaagttactggtgatgttactttcggcccaggcgtcgttattgagggcaag
gtccacatcaagggatctgatgacaagcctgttacaattgaaaacagacacctcaaggat
gagactgttacattttaa

DBGET integrated database retrieval system