KEGG   Trichomonas vaginalis: TVAG_390760Help
Entry
TVAG_390760       CDS       T01022                                 

Definition
acetylpolyamine aminohydrolase
Orthology
K06067  
histone deacetylase 1/2 [EC:3.5.1.98]
Organism
tva  Trichomonas vaginalis
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 453 aa AA seqDB search
MSIPKRRIAYFYDEDIGNYYYTHSHPMKPVRVRMTHSLVLGYKLHEHMDVFHPRRASPEE
MMRFHTPGYIKFLQTATPSNTNPKSEDAVHYNIGFDCPVFDNIFEFCQISAGGSISAAQR
LNYNLADVAINWAGGLHHARRDQASGFCYIADCVLGIMELLKYHPRVMYIDIDIHHGDGV
EEAFYNTDRVLTVSFHKYGKEFFPESGHISDVGINSGKYYAVNVPLRDGMTDEAYHYLFK
PIIRNLIHFYQPGAIFLQCGADSLVGDLLGYFNLSTYGHGECVKFVQSFGIPLLVAGGGG
YIKQSVARCWTYETSLIVNQDIPDELPENDYLEYFQPSYKLHLHPDKKKNLNSEEFLHNI
YVHVMENVRHLAAAPSVQMTELPPRAAMSRPIKVHEETSNFCKRLFMKFQTEDDIQEQKE
QEEAQRMDDEEYAEKMSHEPNPNIPVKEPLPEM
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atgagcatccctaagcggaggattgcttatttttatgacgaagatattggcaattattat
tatactcatagccatcctatgaaacctgtccgtgttcgcatgacgcatagtcttgtgctt
ggctacaaacttcatgaacatatggacgtcttccatccacgcagagcatctccagaagaa
atgatgcgatttcatacaccaggatacatcaaattccttcaaacagcaactccatctaat
acaaatccaaaatccgaagatgcagttcactataatattggtttcgactgccctgttttc
gataatattttcgaattttgccaaatctcggctggtggaagtatcagcgctgctcaaaga
ttgaattacaaccttgcagacgttgcaattaattgggcaggcggcctccatcacgctaga
agagatcaggctagcggattttgttacatagccgattgcgtcctcggcattatggaattg
cttaaatatcatccacgcgttatgtatattgatattgatattcaccacggcgatggcgtt
gaagaagctttttacaatactgaccgtgttttaacggtttccttccataaatatggaaaa
gaattcttcccagaaagtggtcatatttcagatgtcggaattaatagcggtaagtactac
gcagttaatgttcctcttcgtgatggcatgacagacgaagcatatcattacttattcaag
ccaattatcagaaatctcatccatttctaccaaccaggcgcgattttcttacaatgcgga
gcagattcacttgtaggtgatcttctcggctatttcaacctttctacttacggacatggt
gaatgcgttaagtttgtccagtcatttggaattccacttcttgttgcgggcggtggcggc
tacattaagcagagtgttgctcgctgttggacatacgagacctcattaatcgttaatcaa
gatattcccgacgaattaccagaaaatgattatcttgagtacttccaaccatcatacaag
ctccacctccatccagataagaagaagaacctcaactccgaagagtttctccataacatt
tacgtccacgtcatggaaaacgtcagacatctcgcagcagctccttctgtacaaatgacg
gagcttccaccgagagcggccatgtcccgaccaattaaggtgcacgaggaaacctccaat
ttctgtaagagactgtttatgaaattccaaacagaagatgacatccaggaacagaaggaa
caagaggaagcacagagaatggatgacgaggaatacgctgagaagatgagccacgaacct
aaccctaatatacctgttaaagagccattacctgaaatgtaa

DBGET integrated database retrieval system