KEGG   Trichomonas vaginalis: TVAG_397250Help
Entry
TVAG_397250       CDS       T01022                                 

Definition
hypothetical protein
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
tva  Trichomonas vaginalis
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Class
Metabolism; Overview; Carbon metabolism [PATH:tva01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:tva00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:tva00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:tva00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:tva00520]
Metabolism; Biosynthesis of other secondary metabolites; Butirosin and neomycin biosynthesis
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 372 aa AA seqDB search
MTANQFAPIKSWNNGRNPMFCLGCDVGGSGLRIRFSNYFNPSEYIDVKHIKAQNTADALR
HLNELSAKIKKVAPNAESRGAAIAVAGPIKDNTVIFTNWPGKAENRTVSLNQLPKTLFPQ
GHSLFLNDLEAGAYGVIAAEEQGVLSPLFEQMWPEIAPKGKLISDNRTAVLAMGSGLGVA
LIVKTPILQQPLVVPSELGHLQIPTVCFRHKDYLNEQQLIQFVSDHYYNGRQMPEYEDIA
SGRGLCLAYQYEYDRINQVKIPLDQIEGGEVAQLAQKGDKIARKALLYHYLYFMRAAKAV
STTLSCDSVLMALDNQVKNDWFVRSAFDELCEEFYHFIRPDWMKSIRVYTQVKTLNFNIL
GTDYMAHKIADK
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgactgcaaatcagttcgccccgatcaaatcctggaacaatggccgtaatccaatgttc
tgcctcggctgcgatgtcggtggttctggtctccgcatccgcttttcaaattacttcaac
ccaagtgagtacatcgacgtcaagcacatcaaagcacagaatacagctgatgccttaaga
catcttaacgagctttcagctaagatcaagaaagtcgcaccaaacgccgaatcaagaggc
gctgcaattgctgttgcaggtccaattaaggataacactgttatcttcaccaactggcca
ggtaaggctgagaatagaacagtcagcttaaaccagcttccaaagacactcttcccacaa
ggtcattcactcttcctcaacgatcttgaggcaggtgcttacggtgttattgccgctgaa
gagcagggtgttctttctccactcttcgagcagatgtggccggagattgctccaaagggc
aaattaatctccgacaacagaacagcagtccttgctatgggctctggccttggtgttgct
cttatcgttaagacaccaatcctccagcagccacttgtcgtcccatctgagcttggacac
cttcagatcccaactgtttgcttccgccataaggactaccttaacgagcaacagctcatc
caattcgtctcagatcactactacaacggccgccaaatgccagaatacgaagacattgca
tctggcagaggtctttgcttagcttaccaatacgaatacgatcgtattaaccaggtcaag
atcccactcgatcagatcgaaggtggcgaagttgcacaattagctcagaagggtgataag
atcgctagaaaggccctcttataccactacttatacttcatgagagctgctaaggctgtc
tctacaacattgtcttgcgactctgtccttatggctcttgataaccaagttaagaatgat
tggttcgttagatccgctttcgatgaactctgtgaagagttctatcacttcatccgccca
gactggatgaagagcatcagagtctacacacaagttaagactcttaactttaacatcctc
ggtacggattacatggctcataagattgctgataagtaa

DBGET integrated database retrieval system