KEGG   Trichomonas vaginalis: TVAG_397250Help
Entry
TVAG_397250       CDS       T01022                                 

Definition
(RefSeq) hypothetical protein
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
tva  Trichomonas vaginalis
Pathway
tva00010  Glycolysis / Gluconeogenesis
tva00052  Galactose metabolism
tva00500  Starch and sucrose metabolism
tva00520  Amino sugar and nucleotide sugar metabolism
tva01100  Metabolic pathways
tva01110  Biosynthesis of secondary metabolites
tva01130  Biosynthesis of antibiotics
tva01200  Carbon metabolism
Module
tva_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:tva00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TVAG_397250
   00052 Galactose metabolism
    TVAG_397250
   00500 Starch and sucrose metabolism
    TVAG_397250
   00520 Amino sugar and nucleotide sugar metabolism
    TVAG_397250
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    TVAG_397250
Enzymes [BR:tva01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     TVAG_397250
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glucokinase ROK Polysacc_deac_2 HTH_16
Motif
Other DBs
NCBI-GeneID: 4772993
NCBI-ProteinID: XP_001327217
UniProt: A2DXB2
AA seq 372 aa AA seqDB search
MTANQFAPIKSWNNGRNPMFCLGCDVGGSGLRIRFSNYFNPSEYIDVKHIKAQNTADALR
HLNELSAKIKKVAPNAESRGAAIAVAGPIKDNTVIFTNWPGKAENRTVSLNQLPKTLFPQ
GHSLFLNDLEAGAYGVIAAEEQGVLSPLFEQMWPEIAPKGKLISDNRTAVLAMGSGLGVA
LIVKTPILQQPLVVPSELGHLQIPTVCFRHKDYLNEQQLIQFVSDHYYNGRQMPEYEDIA
SGRGLCLAYQYEYDRINQVKIPLDQIEGGEVAQLAQKGDKIARKALLYHYLYFMRAAKAV
STTLSCDSVLMALDNQVKNDWFVRSAFDELCEEFYHFIRPDWMKSIRVYTQVKTLNFNIL
GTDYMAHKIADK
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgactgcaaatcagttcgccccgatcaaatcctggaacaatggccgtaatccaatgttc
tgcctcggctgcgatgtcggtggttctggtctccgcatccgcttttcaaattacttcaac
ccaagtgagtacatcgacgtcaagcacatcaaagcacagaatacagctgatgccttaaga
catcttaacgagctttcagctaagatcaagaaagtcgcaccaaacgccgaatcaagaggc
gctgcaattgctgttgcaggtccaattaaggataacactgttatcttcaccaactggcca
ggtaaggctgagaatagaacagtcagcttaaaccagcttccaaagacactcttcccacaa
ggtcattcactcttcctcaacgatcttgaggcaggtgcttacggtgttattgccgctgaa
gagcagggtgttctttctccactcttcgagcagatgtggccggagattgctccaaagggc
aaattaatctccgacaacagaacagcagtccttgctatgggctctggccttggtgttgct
cttatcgttaagacaccaatcctccagcagccacttgtcgtcccatctgagcttggacac
cttcagatcccaactgtttgcttccgccataaggactaccttaacgagcaacagctcatc
caattcgtctcagatcactactacaacggccgccaaatgccagaatacgaagacattgca
tctggcagaggtctttgcttagcttaccaatacgaatacgatcgtattaaccaggtcaag
atcccactcgatcagatcgaaggtggcgaagttgcacaattagctcagaagggtgataag
atcgctagaaaggccctcttataccactacttatacttcatgagagctgctaaggctgtc
tctacaacattgtcttgcgactctgtccttatggctcttgataaccaagttaagaatgat
tggttcgttagatccgctttcgatgaactctgtgaagagttctatcacttcatccgccca
gactggatgaagagcatcagagtctacacacaagttaagactcttaactttaacatcctc
ggtacggattacatggctcataagattgctgataagtaa

DBGET integrated database retrieval system