KEGG   Trichomonas vaginalis: TVAG_398870Help
Entry
TVAG_398870       CDS       T01022                                 

Definition
hypothetical protein
Orthology
K14310  
nuclear pore complex protein Nup205
Organism
tva  Trichomonas vaginalis
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:tva00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    TVAG_398870
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1208 aa AA seqDB search
MNLKLSGASLASTSIAAPVVFKPAETNFRLTYKKKELETSDFDEVINRCRTLIKKISNPP
SKSSIQYYEEFTRPSFAHFTIENETKPFYDASMAVTEFVGMLTNPYFEPNKQKFVSHIGG
KIQEEWQECSRCPQLQQIMKAAFGIIADIRDFIEKSYTPSLLIFIANTLLLQSSISQTQS
YQLVLEIYAQAFVFKVIEKHKDRIQGFIENERQIKHDYIFAEEAPEKNNTDFRDFIQLVT
VLARMRKDPDFGRHFYSMGTEIISSATDFTQPRFVAAFIKLLASLSVDKETSELVYDRLA
KSNSQLINLPHFLQAISGYADDFNQSQANVAKLSEDDSSTLESIFRLLSSLFKHSELCRR
EIINSNNLINNLITYVSSMIPATLKSCCYDTLSEISQDETYTVEIWKKFVFTEILTPDNV
QSGTGGIILDIEKTELAERAYPLMRSFVRFLSKLVQNAPPPLNFEHIHVFLLEFCLLKLP
DRLYAHFNEKWSILCEICQVWTNLFKYDKVHYNLVMRSALCDQRFIRGLLTIVVEDETPL
ETLLCVYRLLFTISQHEEEFFQNPDSSFHSSVVSLSQQVSWSSDFLKKLILSVAENDKDV
QISAISLSQYLANNAAQIVQVVFTSVKPIPCFIKVIERDEEEEPSKIGNEETCVRVRLLK
FLVSLGSSSYFARYVSGFDVSDPPTSLLKSTLEKGIIPKLVEKMGTTMAAKNYPRFAAAS
LQLMLMLCDHSLTVSPLLSSLRSSPHSFFDRQLVNLQDNHSSMTAIGCFLMLLAREAMES
AKNSSGTTLHVVQILLNVVGFSEQRSRVVLAFEFIDRIDDSDEATLIAKGMFQAVVSFIT
NKNVIISAKHWGNAWISFMIHLLNKITTVSNSETTMYLSQAVGFIGHSIFADKIFGKIDK
HDILVSFNALIEALISLHINRHSDSMLGVYSLFTSLLANREIDEELCQIYLENSSRISSC
FLDDMKNQIPVTKAAVFAAAESLVSFAKDSSLDEFISYSIAQLPTDWLIFDEDNDAGAFV
LGSKFSFFTRVISSGSDPSIFIQRGLITLIGHKSMWESLGESFSTSTNSPISELILQTAS
KAIKAMSALAASSSNNEDVKKQSRQFISDFAETFSSVFQFGGFFTLDALQMITDLVCFMS
LVPSAVDKYLMNRLASLRQRFIGNEQWRELLRKKAGKADIPSPKTYQIAIGMTKRIIMAV
NYMIPQKK
NT seq 3627 nt NT seq  +upstreamnt  +downstreamnt
atgaacttaaaactcagcggtgcctcactagcatcaacatcaattgcggcccctgtagtt
tttaaaccagcagaaaccaattttcgtcttacttataagaaaaaagagcttgaaacttct
gattttgacgaagttataaatcgatgcagaactttgatcaagaagatttcaaatccacca
agcaaaagtagtatacaatactacgaagagtttactcgaccatcatttgctcattttact
atagaaaacgaaacaaaaccattttacgatgcttcgatggctgttacagagtttgtagga
atgctaacgaatccgtattttgaacctaacaagcagaagttcgtcagtcatattggcggc
aaaatccaagaagaatggcaagaatgttctcggtgtcctcagttgcaacaaataatgaaa
gcagcatttggtatcattgccgatattagagactttatagaaaaatcatatactccttct
cttcttattttcatcgcaaacacattattacttcaatcttcgatttctcaaacgcaatct
tatcaattagttctcgaaatatacgctcaggcattcgtatttaaagttatcgaaaagcat
aaagacagaattcaaggatttatcgaaaatgaaagacaaatcaagcatgattacatattt
gctgaggaagcacccgagaaaaacaatacagatttccgagattttatacaattagttact
gtattagctagaatgagaaaagatccagattttggtcgacatttttattcaatgggtaca
gaaatcatttcttcagctacagattttactcagccgcgctttgttgctgcttttattaaa
cttttagcatctttatccgtagataaagaaacatctgaattagtttacgatagattagca
aaatccaactcgcaattgataaatttacctcatttcttacaagccatatcaggttatgca
gatgatttcaatcaatctcaagcaaatgttgcaaaattatcagaagatgattctagtaca
cttgaatcgattttcagattactttcatcattattcaagcatagcgaactatgccgtcgc
gaaattatcaactcaaacaacttaataaataatttaataacttatgtatcatctatgatc
cctgcgaccctcaaatcatgttgctacgataccctatcggaaatttcgcaggatgaaacg
tatacagttgaaatctggaaaaaatttgtttttacagaaattttaacaccggataatgtc
caatctggcaccggcggcatcatccttgatatagagaagacagaattggctgagcgcgct
tatcctcttatgcgttctttcgtgagatttttatcgaaattagtacaaaacgctcctcca
ccgttaaacttcgaacatatccatgtgttcttgcttgagttctgcttattaaagctacca
gatagactatacgcccactttaacgaaaaatggtcgatcttatgcgaaatttgccaagtt
tggactaatttattcaaatacgacaaggtccactacaaccttgttatgcgttctgcgctt
tgcgatcaaagatttatccgtggattacttacaatcgttgtagaagacgaaactccactt
gaaacattattatgcgtatacagattattgtttactatctcccagcatgaagaagagttc
ttccagaacccagattcgagtttccattcatctgtcgtttctttaagccaacaagtatca
tggtcctctgatttccttaagaagctcattctttctgttgcagaaaacgacaaagatgtt
cagatttctgcaatttcattgagccaatacctcgcaaacaacgccgctcagatcgtacag
gtcgtttttacttctgtaaagccaatcccgtgctttatcaaggtcatagaacgcgatgaa
gaggaagaaccgagtaaaattggaaatgaagaaacttgtgtaagggtcagactgcttaaa
ttccttgtatcattagggtcctcgtcgtatttcgctcgttacgttagcggttttgatgtt
tcagatccaccaacttcattattaaagtccacattagagaagggcatcatccccaagctt
gttgagaagatgggaacgacgatggccgccaagaactatccaagattcgcagcagcttcc
cttcagttaatgttaatgctatgcgaccactcattgacggtttctccacttttgagttca
cttcgcagttccccgcactccttcttcgaccgccaactcgtaaatctgcaggacaaccac
tcctccatgactgccattggttgtttcttaatgcttctcgcgagggaagctatggaatca
gccaaaaacagctcaggaacgaccttacacgttgtacagatacttctcaacgttgtcggc
ttctcggagcaaaggtcacgtgttgttcttgccttcgagttcattgatagaatcgatgat
tccgatgaagcaacattaattgcgaaaggaatgttccaagctgttgtttcttttatcaca
aacaagaatgtgatcatttccgccaagcattggggcaatgcatggatctctttcatgata
caccttcttaacaagataacaacagtctccaacagtgaaacaacgatgtatctttctcaa
gcagttggtttcattggccattcaattttcgccgataaaattttcggaaaaattgacaaa
cacgatattttagtatcattcaatgcacttattgaagcattgatatccttacacatcaac
agacacagtgattctatgcttggtgtctattctttgttcacttctttacttgcgaacaga
gaaattgatgaagaactttgtcagatttatcttgagaattcctcacgaatttcttcatgt
ttccttgatgacatgaagaaccagatacctgtaacaaaagcagctgttttcgcagcagca
gaatcattagtaagtttcgcgaaagactcaagtttagatgagtttatttcgtattcaatt
gcacaattaccaactgattggttaattttcgatgaagataatgatgcaggcgctttcgtt
cttggcagcaaattctccttctttacaagagttatttcaagtggttctgatccttccatt
tttattcagagaggattaatcactttgattggtcataaatcgatgtgggaatcacttgga
gagtcattctctacatcaacgaactctccaatatctgaattgatattgcagacagcttct
aaagcaatcaaagcaatgtctgcactcgcggcaagttcttctaataatgaagacgtaaag
aaacaaagtcgacaatttatttctgatttcgctgaaacattttcaagtgtatttcagttt
ggcggcttctttactttggacgctttgcagatgatcactgacttagtttgtttcatgtca
ttagttccatcagctgttgataagtatctgatgaatagattggcatcattaagacaaaga
tttattggaaatgaacaatggagagaattgctgagaaaaaaggctggaaaagctgatatt
ccttcgccaaagacgtaccagatagcaattggaatgactaagaggataatcatggcagtg
aattacatgattccacaaaagaaatga

DBGET integrated database retrieval system