KEGG   Trichomonas vaginalis: TVAG_426760Help
Entry
TVAG_426760       CDS       T01022                                 

Definition
acetylpolyamine aminohydrolase
Orthology
K06067  
histone deacetylase 1/2 [EC:3.5.1.98]
Organism
tva  Trichomonas vaginalis
Brite
Enzymes [BR:tva01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     TVAG_426760
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 394 aa AA seqDB search
MKKRIVYFYDDDIGNFMYNQGHPMKPHRIRMAHNLIMAYELFSSMRVLRPRRATALDMTR
FHTDEYVQFLQVATPKNTSGDDPVLEKFNIDGDSPVFNGVFEFCQISAGGSISGAQELIS
GKCDIAINWAGGLHHAKKAEASGFCYCADCVLGILKLLDRYDRVMYIDIDIHHGDGVEEA
FYTTDRVLTVSFHKYGDDFFPCTGNKNDIGIDRGKGYAVNVPLSDGLDDAAFESIFKPVM
SRLIEWYRPGAILLQCGADSLTGDRIGCFNLTLKGHAMAVEFIKNLKIPLLVTGGGGYTV
RNVARCWAYETAVLTETPISDELPYNEYMGYFGPDYRLHLQPSNMENTNSEQDLNDLMQL
IDNHMKDAQAAPSVDWALGVGTQKKIDALGNVVN
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgaagaagagaatagtttacttctatgatgatgatattggaaatttcatgtataatcaa
ggtcacccaatgaaaccacatcgtatacgtatggcacacaacttaatcatggcgtacgaa
ctattttcaagtatgcgtgttttgagaccacgccgtgcgaccgccctcgatatgacaaga
tttcatacagacgaatacgttcaatttttacaagttgcaacaccgaaaaatacaagtggc
gacgatccagttttagaaaaattcaacatcgatggagattcaccagttttcaacggagta
tttgaattctgtcaaatatctgcaggtggttctatctccggagctcaagaattaatttca
ggaaagtgcgacattgcgattaactgggccggtggtctccaccacgccaagaaagccgaa
gccagtggtttctgctactgtgcagactgtgttcttggtattctcaagttattagatcgt
tacgacagagttatgtacattgatattgatattcaccatggcgatggcgttgaagaagcc
ttctatactactgatcgcgtacttacagtatcattccacaagtatggtgatgatttcttc
ccatgcacaggcaataagaatgatatcggcatcgaccgcggaaaaggttatgccgtcaac
gttcctctcagcgacggacttgacgatgccgccttcgagagcatcttcaaaccagtcatg
agccgtctcatcgagtggtacaggccaggagccattcttctccaatgcggagcagattct
ttgacaggagacagaattggatgcttcaacctcactctcaagggtcacgccatggccgta
gagttcatcaagaacctcaagatccctctcttggtcacaggaggtggtggttacacagta
agaaatgtcgcaagatgctgggcatatgaaacagccgttttgacagaaacaccgatatct
gatgaattaccatataacgagtatatgggatacttcggtcctgactacagattgcacttg
cagccttcaaacatggaaaacacaaattctgaacaagatctgaatgacctcatgcagtta
atcgataatcacatgaaggatgcacaagcggcaccatcagtcgattgggcacttggtgtt
ggtactcagaagaagatagatgctctcggcaatgttgttaattag

DBGET integrated database retrieval system