KEGG   Trichomonas vaginalis: TVAG_432270Help
Entry
TVAG_432270       CDS       T01022                                 

Definition
(RefSeq) hypothetical protein
Organism
tva  Trichomonas vaginalis
SSDB OrthologParalogGFIT
Motif
Pfam: Raptor_N HEAT_2 DUF4221 Cohesin_HEAT
Motif
Other DBs
NCBI-GeneID: 4756477
NCBI-ProteinID: XP_001311607
UniProt: A2F8U1
AA seq 1028 aa AA seqDB search
MTSSGTTSKAFINNAGPNFIQSRIIDGENTSDPLYGDWLHNEFLVSIHPPNYPPEPVDFP
ALTFTTQGIVVMCIPNLLQPPHLRGTNSVYCWSKTSTESTSNPQQEIAKAIVTQYQQCMP
KMALAARVNPTINDFKNSLSKIKLQNSSVRTLFHYASHGGPDVSSQYIMLHSPDKQSFDH
FPIESVLTATDSCSVHILDCDNAGALINAYRSFISDKADSGIKMDLFAFFACGSRERLPR
SPDLPHDVFTSCMTTPARIALLWHSRHYYCFKNGPLRPLNTDLFKSSPNSILDDISLILH
RLVEAMAFEVFPPDLFMRVFRTDSSIAHLAANYFLACRMLSFFGVQPKSIPEMPDVSNHS
LWHTFDLRLDVALQQLHSPAPDPSLSYTVFLEQSLKTLKHLMNVSTKDISFPGQLTLIPP
ALTTPSLQAEGSKVLALYIDKSISAVRQMWYFPIAVPLFQMLTSPSCNEYLLLAVAKTLC
FMPSARAILREISKETFKTVLSPLLKQENSVFALVIATIYHFENNEAISQLVQNDWSSTI
LSLFDDSHTDVRLWTLLFVATFVNYIPDRDLMMKTAAKITNLSSDYSPEVRIASLHALCS
LIKCDIETEIVKVAKELVHDPNSSVRCELIILLSNATKANPKLLENKDVQLSLVELACDP
HPLVKRLMENFTQSVYPSFILQWFSRAILSPIKSLLTDDKLRLSNVQPTISLPARQPNKS
MITIGRATSFRLLQTHSVCSSNFTSLFDGNAALFGSNSGEIVYAQWDANVQRSVRISNKQ
IKHVQCISNSGYPLIISSDSHSNLRFLNSDLQTITAFKLNQNHSLFEFLESDRKLLTFST
LQKNILVYDMKSEKISQTIDSIGDNIQCVRALNHLNDVVAVVSDKKLNFVDLRTNSNVIS
SPDGLSLFDVAQLDKSANLFAIAHKCGTVSLFDARFNEPIKRYQASPESSPILSFAVQSE
SGACAIGSSKGVCVIDILGGKRIEYNSVPSLLFSRNLEAVNACCFSPTKFSLAVLQGQSD
ILFLDDAS
NT seq 3087 nt NT seq  +upstreamnt  +downstreamnt
atgacgtcttcaggaacaacttctaaggcgttcatcaataatgcaggcccaaatttcatc
caatcacgcataattgatggagaaaatacatcagatccactttatggggattggcttcat
aatgaatttttagtttcaattcatccaccaaattatccaccagaaccagtagatttccca
gcattaacattcacaacacaaggaattgtcgttatgtgcataccaaacttactccaacct
cctcatttaagaggaacaaattctgtttattgttggtctaaaaccagcacagaatcaaca
tcaaatccgcaacaagaaattgcgaaagcaattgtcacacaataccaacaatgcatgccg
aaaatggctttagcagcaagagttaatccgactatcaatgatttcaagaattctctttct
aaaatcaagctccaaaactcatcagttcgaaccctcttccattatgcttcacatggaggc
ccagatgtttcatctcaatacataatgttgcattccccagacaaacaatcatttgatcac
ttccctatcgagagtgttctcaccgctacagattcctgcagcgttcacatactagattgt
gacaatgccggtgcattaatcaacgcatacagatcatttatctcagacaaagcagattca
ggtataaagatggatcttttcgcattctttgcatgtggaagtcgcgaaagattaccaaga
tccccagatttacctcatgatgtctttacttcttgtatgacaactcctgctcgcattgca
ttactctggcattctcgccattactactgctttaagaatggaccactccgaccactaaat
acagaccttttcaagtcatctccaaatagtattttggatgacatcagtttaatactccac
agacttgtagaagccatggcattcgaagtattccctccagatctcttcatgagagtcttc
agaactgattcttccattgcacatttagcagcaaactattttctcgcttgtaggatgctt
tctttctttggagtccaaccgaaatcgattccagagatgccagatgtctcaaatcattca
ttatggcatacttttgacctcagattagatgttgctttacagcagcttcattctccagct
ccagacccctcattatcatacacagtgttcttagaacaatccctcaaaactctcaagcat
ctaatgaacgtttcaacaaaagatatttcatttcctggccaattaactttaattccgcca
gctcttacaacgccatcgctacaagcggaaggtagtaaagtactcgcattatacatcgat
aaaagtatctcagctgtcagacaaatgtggtatttcccgattgcagtacctcttttccaa
atgctgacctctccatcgtgtaatgaatatttattgcttgctgttgccaaaaccttatgc
tttatgccttcagccagagcgattcttcgagaaatcagcaaagaaacattcaaaacagtt
ctttctcctttgctgaaacaagagaactcagtcttcgctcttgtcatcgctaccatttac
catttcgagaataatgaggccatttcccaattagtacaaaatgattggtcatctacaatc
ttgtcactttttgatgattcccatacagatgtacggttatggacattattatttgtagca
acatttgtgaattacataccggatagagatcttatgatgaagactgctgcaaaaataact
aatttgtcctcagattattcgccagaagtcagaattgccagtttacatgcactatgttcg
ctaatcaagtgcgatatcgaaacagaaatagttaaagttgcaaaagagttggttcatgac
cccaattcttcagtaagatgcgaattaataattttactttctaatgcgacaaaagcaaat
ccgaaattacttgagaacaaggatgtacagttgtcactcgttgaattggcttgcgatccc
catcctttggtgaagagattaatggaaaacttcacacagtcagtttatccatcatttata
cttcagtggttctcaagggccattctaagccctataaaatcactccttaccgatgataaa
cttagattatccaatgttcagccaacaatttcgcttcctgctcgtcagccaaacaaatct
atgattacaattggcagagcaacatcattccgactcttacaaactcattcagtctgttct
tcgaactttacatctttatttgacggaaatgctgctttatttggctccaactccggcgaa
atcgtttatgcccaatgggatgccaatgtacaacgaagcgttcgcatttccaacaaacag
attaagcatgttcagtgtatttcaaattctggctatcctctgattatttcttctgattcc
cacagtaatttacgtttccttaactccgatttacagaccataaccgcattcaaactcaac
cagaaccactctttgttcgaatttctcgaatctgacagaaaacttttgacattttcaact
ttacaaaaaaatattttggtttatgacatgaaaagtgagaaaataagccaaactatcgat
tcaatcggtgacaacatacagtgcgtgagggctctcaaccacttgaacgatgttgtcgct
gttgtttccgataaaaaactcaatttcgtagatttgagaacaaattcgaacgtaatttct
tcgcccgacggtttgtcactttttgacgtggcccaacttgacaagagtgcaaatttgttt
gcaattgcacacaaatgcggtactgtatcccttttcgatgcaagatttaacgaaccaata
aaaagatatcaggcatctcctgaatcttcaccgattttatcatttgcagtacagtctgag
tctggtgcttgcgcaatagggtcttccaaaggggtctgcgtcatagatatcctcggcgga
aagagaattgaatacaattctgttccatctcttttgttttcaaggaatttagaggctgtt
aacgcttgctgcttctcacctactaaattttctcttgctgtactccagggacaatctgat
atcttattcttggatgatgcatcgtag

DBGET integrated database retrieval system