KEGG   Trichomonas vaginalis: TVAG_432270Help
Entry
TVAG_432270       CDS       T01022                                 

Definition
hypothetical protein
Orthology
K07204  
regulatory associated protein of mTOR
Organism
tva  Trichomonas vaginalis
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1028 aa AA seqDB search
MTSSGTTSKAFINNAGPNFIQSRIIDGENTSDPLYGDWLHNEFLVSIHPPNYPPEPVDFP
ALTFTTQGIVVMCIPNLLQPPHLRGTNSVYCWSKTSTESTSNPQQEIAKAIVTQYQQCMP
KMALAARVNPTINDFKNSLSKIKLQNSSVRTLFHYASHGGPDVSSQYIMLHSPDKQSFDH
FPIESVLTATDSCSVHILDCDNAGALINAYRSFISDKADSGIKMDLFAFFACGSRERLPR
SPDLPHDVFTSCMTTPARIALLWHSRHYYCFKNGPLRPLNTDLFKSSPNSILDDISLILH
RLVEAMAFEVFPPDLFMRVFRTDSSIAHLAANYFLACRMLSFFGVQPKSIPEMPDVSNHS
LWHTFDLRLDVALQQLHSPAPDPSLSYTVFLEQSLKTLKHLMNVSTKDISFPGQLTLIPP
ALTTPSLQAEGSKVLALYIDKSISAVRQMWYFPIAVPLFQMLTSPSCNEYLLLAVAKTLC
FMPSARAILREISKETFKTVLSPLLKQENSVFALVIATIYHFENNEAISQLVQNDWSSTI
LSLFDDSHTDVRLWTLLFVATFVNYIPDRDLMMKTAAKITNLSSDYSPEVRIASLHALCS
LIKCDIETEIVKVAKELVHDPNSSVRCELIILLSNATKANPKLLENKDVQLSLVELACDP
HPLVKRLMENFTQSVYPSFILQWFSRAILSPIKSLLTDDKLRLSNVQPTISLPARQPNKS
MITIGRATSFRLLQTHSVCSSNFTSLFDGNAALFGSNSGEIVYAQWDANVQRSVRISNKQ
IKHVQCISNSGYPLIISSDSHSNLRFLNSDLQTITAFKLNQNHSLFEFLESDRKLLTFST
LQKNILVYDMKSEKISQTIDSIGDNIQCVRALNHLNDVVAVVSDKKLNFVDLRTNSNVIS
SPDGLSLFDVAQLDKSANLFAIAHKCGTVSLFDARFNEPIKRYQASPESSPILSFAVQSE
SGACAIGSSKGVCVIDILGGKRIEYNSVPSLLFSRNLEAVNACCFSPTKFSLAVLQGQSD
ILFLDDAS
NT seq 3087 nt NT seq  +upstreamnt  +downstreamnt
atgacgtcttcaggaacaacttctaaggcgttcatcaataatgcaggcccaaatttcatc
caatcacgcataattgatggagaaaatacatcagatccactttatggggattggcttcat
aatgaatttttagtttcaattcatccaccaaattatccaccagaaccagtagatttccca
gcattaacattcacaacacaaggaattgtcgttatgtgcataccaaacttactccaacct
cctcatttaagaggaacaaattctgtttattgttggtctaaaaccagcacagaatcaaca
tcaaatccgcaacaagaaattgcgaaagcaattgtcacacaataccaacaatgcatgccg
aaaatggctttagcagcaagagttaatccgactatcaatgatttcaagaattctctttct
aaaatcaagctccaaaactcatcagttcgaaccctcttccattatgcttcacatggaggc
ccagatgtttcatctcaatacataatgttgcattccccagacaaacaatcatttgatcac
ttccctatcgagagtgttctcaccgctacagattcctgcagcgttcacatactagattgt
gacaatgccggtgcattaatcaacgcatacagatcatttatctcagacaaagcagattca
ggtataaagatggatcttttcgcattctttgcatgtggaagtcgcgaaagattaccaaga
tccccagatttacctcatgatgtctttacttcttgtatgacaactcctgctcgcattgca
ttactctggcattctcgccattactactgctttaagaatggaccactccgaccactaaat
acagaccttttcaagtcatctccaaatagtattttggatgacatcagtttaatactccac
agacttgtagaagccatggcattcgaagtattccctccagatctcttcatgagagtcttc
agaactgattcttccattgcacatttagcagcaaactattttctcgcttgtaggatgctt
tctttctttggagtccaaccgaaatcgattccagagatgccagatgtctcaaatcattca
ttatggcatacttttgacctcagattagatgttgctttacagcagcttcattctccagct
ccagacccctcattatcatacacagtgttcttagaacaatccctcaaaactctcaagcat
ctaatgaacgtttcaacaaaagatatttcatttcctggccaattaactttaattccgcca
gctcttacaacgccatcgctacaagcggaaggtagtaaagtactcgcattatacatcgat
aaaagtatctcagctgtcagacaaatgtggtatttcccgattgcagtacctcttttccaa
atgctgacctctccatcgtgtaatgaatatttattgcttgctgttgccaaaaccttatgc
tttatgccttcagccagagcgattcttcgagaaatcagcaaagaaacattcaaaacagtt
ctttctcctttgctgaaacaagagaactcagtcttcgctcttgtcatcgctaccatttac
catttcgagaataatgaggccatttcccaattagtacaaaatgattggtcatctacaatc
ttgtcactttttgatgattcccatacagatgtacggttatggacattattatttgtagca
acatttgtgaattacataccggatagagatcttatgatgaagactgctgcaaaaataact
aatttgtcctcagattattcgccagaagtcagaattgccagtttacatgcactatgttcg
ctaatcaagtgcgatatcgaaacagaaatagttaaagttgcaaaagagttggttcatgac
cccaattcttcagtaagatgcgaattaataattttactttctaatgcgacaaaagcaaat
ccgaaattacttgagaacaaggatgtacagttgtcactcgttgaattggcttgcgatccc
catcctttggtgaagagattaatggaaaacttcacacagtcagtttatccatcatttata
cttcagtggttctcaagggccattctaagccctataaaatcactccttaccgatgataaa
cttagattatccaatgttcagccaacaatttcgcttcctgctcgtcagccaaacaaatct
atgattacaattggcagagcaacatcattccgactcttacaaactcattcagtctgttct
tcgaactttacatctttatttgacggaaatgctgctttatttggctccaactccggcgaa
atcgtttatgcccaatgggatgccaatgtacaacgaagcgttcgcatttccaacaaacag
attaagcatgttcagtgtatttcaaattctggctatcctctgattatttcttctgattcc
cacagtaatttacgtttccttaactccgatttacagaccataaccgcattcaaactcaac
cagaaccactctttgttcgaatttctcgaatctgacagaaaacttttgacattttcaact
ttacaaaaaaatattttggtttatgacatgaaaagtgagaaaataagccaaactatcgat
tcaatcggtgacaacatacagtgcgtgagggctctcaaccacttgaacgatgttgtcgct
gttgtttccgataaaaaactcaatttcgtagatttgagaacaaattcgaacgtaatttct
tcgcccgacggtttgtcactttttgacgtggcccaacttgacaagagtgcaaatttgttt
gcaattgcacacaaatgcggtactgtatcccttttcgatgcaagatttaacgaaccaata
aaaagatatcaggcatctcctgaatcttcaccgattttatcatttgcagtacagtctgag
tctggtgcttgcgcaatagggtcttccaaaggggtctgcgtcatagatatcctcggcgga
aagagaattgaatacaattctgttccatctcttttgttttcaaggaatttagaggctgtt
aacgcttgctgcttctcacctactaaattttctcttgctgtactccagggacaatctgat
atcttattcttggatgatgcatcgtag

DBGET integrated database retrieval system