KEGG   Trichomonas vaginalis: TVAG_441100Help
Entry
TVAG_441100       CDS       T01022                                 

Definition
Guanylate kinase family protein
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
tva  Trichomonas vaginalis
Pathway
Purine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tva00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    TVAG_441100
Enzymes [BR:tva01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     TVAG_441100
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 190 aa AA seqDB search
MPHPIVFVGPSGIGKGTIIGKLRELYPGRFDFSVSHTTRQPREGETDGVQYHFVTREKFQ
EMVKNGEFLEHADIHGNCYGTSFAAIHQVEATGKICILDVNIDGAMAVYKSEMTPFIILL
KPTSFEALEARLRGRGTETEEQIQRRLQTTRRELQLYEENKDMFDLAIINDKLEDTLNKI
IEELLKRYTL
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atgccgcatccaattgtatttgtcggcccatcaggtattggaaagggaacaatcattgga
aagctaagagaactctatccaggcagatttgacttctccgttagccacacaactcgtcag
ccaagagaaggagaaaccgatggcgttcaataccacttcgtaactcgcgaaaaattccaa
gaaatggttaagaatggtgagttccttgagcatgctgacatccacggtaattgctatggt
acatcatttgctgccattcatcaagtcgaagctacaggcaagatttgcatcctcgatgtt
aacattgatggtgctatggcagtctacaaatctgaaatgacaccgttcattatccttctt
aagccaacttcattcgaagcacttgaagctcgtcttcgtggaagagggactgaaactgaa
gagcaaattcagagacgtcttcaaactactagaagagagcttcagttatatgaagaaaac
aaagatatgtttgatttggctatcatcaacgataaactcgaagatacacttaacaaaatc
atcgaagaactcctcaaaagatacacactttaa

DBGET integrated database retrieval system