KEGG   Trichomonas vaginalis: TVAG_441520Help
Entry
TVAG_441520       CDS       T01022                                 

Definition
Guanylate kinase family protein
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
tva  Trichomonas vaginalis
Pathway
Purine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:tva00230]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 191 aa AA seqDB search
MSRPIVFVGPSGIGKGTIIGKLRELYPGRFDFSVSHTTRKPREGETDGVQYNFVTRKKFE
EMIKNGEFLEHAEVHGNYYGTSFAAIHHVEESGKICILDINIDGAIAVYKSNMTPYIILL
KPTSFEALEARLRGRATETEEQIQKRLQTTKRELERYEELKDMFDLTIINDRLDVTLIKI
SEELFKRYKLP
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcgtcccattgtatttgtaggcccatctggtatcggcaagggaacaatcattgga
aagcttagagaactttaccctggtagatttgatttctccgttagccatacaacacgtaag
ccaagagaaggagaaacagatggcgttcaatataatttcgttacccgcaaaaaattcgaa
gaaatgatcaagaatggagaattcctcgaacatgctgaagttcacggcaattattatggt
acatcttttgccgccattcatcatgttgaagaatctggcaagatttgcatccttgatatt
aacattgatggtgctattgctgtatataagtccaacatgactccatatatcattcttctc
aagccaacttcattcgaagcacttgaagctcgtcttcgtggaagagcaactgaaacagaa
gaacaaattcaaaagcgtctccaaaccactaaaagagaacttgaaagatacgaagaactt
aaggatatgttcgatttaaccattattaatgatcgccttgacgttacactcattaaaata
tcagaggagctcttcaagagatataaactcccataa

DBGET integrated database retrieval system